Items where Subject is "Institute of Propulsion Technology"
![]() | Up a level |
- Institutes and Facilities (148430)
- Institute of Propulsion Technology (4727)
- Combustor (193)
- Combustor Test (3)
- Fan and Compressor (443)
- Numerical Methodes (343)
- Engine (303)
- Engine Acoustic (1485)
- Turbine (310)
- Institute of Propulsion Technology (4727)
| Abu-Zurayk, Mohammad and Görtz, Stefan and Brodersen, Olaf (2022) MDO APPLICATIONS AND STUDIES AT DLR FOR ENERGY EFFICIENT AIRCRAFT. 3rd European Workshop on MDO for industrial applications in Aeronautics – Towards Greener Aviation, 2022-09-20 - 2022-09-21, Paris. Volltext nicht frei. |
| Achterberg, K. (1991) Untersuchungen zur Auslegung eines Überschalldiffusors für einen Schubdüsenprüfstand. Diploma, RWTH Aachen. Volltext nicht online. |
| Alrutz, Thomas and Aumann, Petra and Basermann, Achim and Feldhoff, Kim and Gerhold, Thomas and Hunger, Jörg and Jägersküpper, Jens and Kersken, Hans-Peter and Knobloch, Olaf and Kroll, Norbert and Krzikalla, Olaf and Kügeler, Edmund and Müller-Pfefferkorn, Ralph and Puetz, Mathias and Schreiber, Andreas and Simmendinger, Christian and Voigt, Christian and Zscherp, Carsten (2009) HICFD – Hocheffiziente Implementierung von CFD-Codes für HPC-Many-Core-Architekturen. In: PARS-Mitteilungen (ISSN 0177-0454), 26, pp. 27-35. 22. PARS-Workshop, 2009-06-04 - 2009-06-05, Parsberg in der Oberpfalz, Deutschland. ISSN ISSN 0177-0454. |
| Amecke, J. (2001) Kalibrierung von zwei Temperatursonden. DLR-Interner Bericht. 225-2001 C 06. 16 S. Volltext nicht online. |
| Amecke, J. (2002) Vorüberlegungen für einen neuen Turbinenprüfstand im DLR. DLR-Interner Bericht. 225-2002 A 04. 47 S. Volltext nicht online. |
| Amecke, J. (2002) Vorbereitung des KWU-Gitterkanals für Messungen mit Überschallzuströmgeschwindigkeiten. DLR-Interner Bericht. 225-2002 C 07. 25 S. Volltext nicht online. |
| Amecke, J. (2004) Neues Forschungsprogramm für Kondensation in Dampfturbinen. DLR-Interner Bericht. 225 - 2004 A 10. 50 S. Volltext nicht online. |
| Ardey, S. and Fottner, L. and Beversdorff, M. and Weyer, H. (1997) Laser-2-Focus Measurements on a Turbine Cascade with Leading Edge Film Cooling. In: Proc. 90th Symp. of AGARD-PEP on "Advanced Non-intrusive Instrumentation for Propulsion Engines" 1997. 90th Symp. of AGARD-PEP on "Advanced Non-intrusive Instrumentation for Propulsion Engines", Oct. 20-24, Brüssel, 1997. Volltext nicht online. |
| Ardey, S. and Langowsky, C. and Fottner, L. (1997) Aerodynamische Mischungsanalyse filmgekühlter Turbinenschaufelgitter. DGLR-JT-97-155, DGLR-Jahrestagung, Okt. 1997, München. Volltext nicht online. |
| Arnold, F. and Hahn, J. and Michalke, A. and Neise, W. (1995) Zur Schalleistungsmessung in Strömungskanälen mit Schlitzrohrsonden. In: Fortschritte der Akustik - DAGA '95, pp. 531-534. DPG GmbH, Bad Honnef. DAGA '95, Saarbrücken, 14.-17.03.1995. Volltext nicht online. |
| Arnold, F. and Hahn, J. and Michalke, A. and Neise, W. (1996) Berechnung neuer Korrekturwerte für die Schalleistungsmessung nach dem Kanal-Verfahren DIN EN 25136. DLR-Interner Bericht. 92517-96/B2. 23 S. Volltext nicht online. |
| Arold, M. (1995) Experimental Investigation of instationary dispersion Characteristics of a flatsheet atomizer. DLR-Interner Bericht. 111 S. Volltext nicht online. |
| Ashcroft, G. and Schultz, J. (2004) Numerical Modelling of Wake-Jet Interaction with Application to Active Noise Control in Turbomachinery. 10th AIAA/CEAS Aeroacoustics Conference, Manchester UK, 10.05.04. Volltext nicht online. |
| Ashcroft, G. and Schulz, J. (2004) Numerical modelling of wake-jet interaction with application to active noise control in turbomachinery. In: Proceedings CFA/DAGA04, pp. 823-824. CFA/DAGA 04, März 2004, Straßburg, Straßburg. Volltext nicht online. |
| Ashcroft, G. and Schulz, J. (2004) Numerical modelling of wake-jet interaction with application to active noise control in turbomachinery. In: Proceedings 10th AIAA/CEAS Aeroacoustics Conference. 10th AIAA/CEAS Aeroacoustics Conference, Manchester, England, 10. - 12. May 2004. Volltext nicht online. |
| Ashcroft, G. and Schulz, J. (2004) Numerical Modelling of Wake-Jet Interaction with Application to Active Noise Control. CFA/DAGA Joint Congress, Strasbourg, 22.-25.3.2004, Strasbourg. Volltext nicht online. |
| Atanasov, Georgi (2022) Plug-In Hybrid-Electric Regional Aircraft Concept for IMOTHEP. EASN 2022, 2022-10-18 - 2022-10-21, Barcelona, Spanien. (Unpublished) |
| Backhaus, Jan and Bolten, M. and Doganay, O.T. and Ehrhardt, M. and Engel, B. and Frey, C. and Gottschalk, H. and Günther, M. and Hahn, C. and Jäschke, J. and Jaksch, P. and Klamroth, K. and Liefke, A. and Luft, D. and Mäde, L. and Marciniak, V. and Reese, M. and Schultes, J. and Schulz, V. and Schmitz, S. and Steiner, J. and Stiglmayr, M. (2020) GivEn - Shape Optimization for Gas Turbines in Volatile Energy Networks. In: Mathematical MSO for Power Engineering and Management Mathematics in Industry. Springer. Volltext nicht online. |
| Backhaus, Jan and Engels-Putzka, Anna and Frey, Christian (2016) a code-coupling approach to the implementation of discrete adjoint solvers based on automatic differentiation. In: 7th European Congress on Computational Methods in Applied Sciences and Engineering, ECCOMAS Congress 2016. VII European Congress on Computational Methods in Applied Sciences and Engineering, ECCOMAS Congress 2016, 2016-06-05 - 2016-06-10, Kreta, Griechenland. doi: 10.7712/100016.2076.6428. Volltext nicht online. |
| Balling, Lothar and Wiedermann, Alexander and Braun, Jost and Rossig-Kruska, Frank and Dibelius, Günther and Mönig, Reinhard and Waltke, Ulrich and Bals, Herbert F.J. and Vogeler, Konrad and Sattelmayer, Thomas and Krebs, Werner and Hellat, Jaan and Eroglu, Adnan and Deuker, Eberhard and Kroll, Wolfgang and Heilos, Andreas and Huth, Michael and Karg, Jürgen and Waldinger, Roger and Köller, Ulf D. and van den Toorn, Bernd and Bolms, Hans-Thomas and Reichert, Arnd W. and Weigand, Bernhard and Schulte, Joachim and Müller, Michael and Janssen , Manfred and Maldfeld, Ekkehard and Verstege, Stefan and Böckel, Frank and Grote, Holger and Taut, Christine and Kollenberg, Wolfgang and Rettig, Uwe and Czech, Norbert and Berger, Christina and Grünling, Hermann W. and Becker, Bernhard and Paschmann, Willi and Wegen, Michael and Wutsdorff, Peter and Werner, Klaus and König, Olaf and Lechner, Christof and Stefan, L.F. Frank and Woditschka, Frank and Bauer, Andreas and Rofka, Stefan and Drobner, Olaf and Pahl, Andreas and Brummel, Hans-Gerd and Inceoglu, Ayhan and Bohrenkämper, Gerhard and Steinwachs, Christopher (2010) Stationäre Gasturbinen 2., neu bearbeitete Auflage. In: Stationäre Gasturbinen Spinger Verlag Berlin; Heidelberg . pp. 1-1120. ISBN 978-3-540-92787-7 // e-ISBN 978-3-540-92788-4 . Volltext nicht online. |
| Bannasch, R. and Bechert, D. W. (1995) Boundary Layer Effects Subjected to Multiple Curvatures and Pressure Gradients in Fast Swimming Animals. Euromech Colloquium 332 "Drag Reduction"; 9th European Drag Reduction Meeting, Ravello/Italy, 19-21 April 1995. Volltext nicht online. |
| Barricau, P. and Lempereur, C. and Mignosi, A. and Mathé, J.-M. and Roehle, I. and Schodl, R. and Willert, C. (2001) ONERA/DLR activities on Doppler global velocimetry and its qualification for wind tunner applications. Proceedings: 3th ONERA/DLR Aerospace Symposium, Paris, France, 20-22 June 2001.. Volltext nicht online. |
| Barsikow, B. (1) and King III, W. F. (1996) Acoustical investigations of a full-scale DSA-350-SEK pantograph in an anechoic open-jet wind tunnel. DLR-Interner Bericht. Technical Document 1A 6G09 T1.DZ, Deutsch-Französische Kooperation, Anhang K2 (1996).. Volltext nicht online. |
| Bartenwerfer, M. and Neise, W. (1995) FANCET - Ein Computerprogramm zur Berechnung von Ventilatorgeräuschpegeln und -spektren aus Modellmessungen. In: Fortschritte der Akustik - DAGA '95, pp. 559-562. DPG GmbH, Bad Honnef. DAGA `95, Saarbrücken, 14.-17.03.1995. Volltext nicht online. |
| Bartenwerfer, M. and Neise, W. (1995) FANCET - a method and a computer program based on acoustic similarity to predict fan noise levels and spectra using model fan noise data. In: Proceedings Euro-noise '95, CETIM (1995), pp. 893-898. Euro-noise `95, Lyon, 21-23 March 1995. Volltext nicht online. |
| Bartenwerfer, M. and Neise, W. (1995) FANCET - eine Methode und ein Rechenprogramm zur Berechnung von Ventilatorgeraeuschpegeln und -spektren aus Messungen an Modellen. DLR-Interner Bericht. 92517-95/B1. 69 S. Volltext nicht online. |
| Basermann, Achim and Kersken, Hans-Peter (2009) Parallel Iterative Solvers for Block-Structured CFD Problems. 38th SPEEDUP Workshop on High-Performance Computing, 2009-09-07 - 2009-09-08, Lausanne, Schweiz. |
| Basermann, Achim and Kersken, Hans-Peter and Frey, Christian (2010) Parallele Gleichungslöser für die linearen TRACE-Module. Software-Innovationen für die Luftfahrtforschung, 2010-04-19 - 2010-04-20, Braunschweig, Deutschland. |
| Baumann, W. W. and Thiele, F. (1990) Heat and Mass Transfer in Evaporating Two-Component Liquid Film Flow. Int. J. Heat and Mass Transfer 33, pp. 267-273. Volltext nicht online. |
| Baumann, W. W. and Thiele, F. (1990) Effect of Phase Equilibrium on the Interfacial Transfer Behavior in Evaporating Two-Component Liquid Film Flow. In: Proceedings Advances in Gas-Liquid Flows, pp. 389-396. Advances in Gas-Liquid Flows, 25-30 November 1990, Dallas, USA. Volltext nicht online. |
| Bechert, D. and Bruse, M. and Hage, W. and van der Hoeven, J.G.T. and Hoppe, G. (1997) Experiments on drag-reducing surfaces and their optimization with an adjustable geometry. Journal of Fluid Mechanics (338), pp. 59-87. Volltext nicht online. |
| Bechert, D. W. (1995) Calibration of Preston Tubes. AIAA Journal, Vol. 33 (12). Volltext nicht online. |
| Bechert, D. W. (1995) Künstliche Haifischhaut-Optimierung im Labor und in der Natur. Seminar "Bionik - Von der Natur lernen - naturgemäß handeln", Hamburg, 22. Juni 1995. Volltext nicht online. |
| Bechert, D. W. (1995) Überlegungen zur Verlustminderung in Strömungsmaschinen. Seminar am DLR-Institut für Antriebstechnik, Köln, 23. Januar 1995. Volltext nicht online. |
| Bechert, D. W. (1996) Reibungsarme Oberfläche, Modell Hai. In: Bionik, Zukunftstechnik lernt von der Natur Landesmuseum für Technik und Arbeit, Mannheim 1996, S. 30-31, 4 Bild.. Volltext nicht online. |
| Bechert, D. W. (1996) Calibration of Preston tubes. AIAA Journal Vol. 34 (1996) No. 1, 205-206. Volltext nicht online. |
| Bechert, D. W. (1996) Methoden der Widerstands-Reduktion. Seminar für Luft- und Raumfahrt, TU Berlin, 28.6.1996. Volltext nicht online. |
| Bechert, D. W. (1996) Vortex-Generatoren auf Windenergieanlagen. Strategiegespräch Geräuschminderung von Windenergieanlagen, Erfurt, 5.-6.2.1996. Volltext nicht online. |
| Bechert, D. W. (1996) Rückstrombremsen als Hochauftriebshilfen. DASA-Airbus, Bremen, 20.11.1996. Volltext nicht online. |
| Bechert, D. W. (1996) Turbulenzbeeinflussung zur Widerstandsverminderung. DLR-Interner Bericht. Internes Handout, DLR Berlin (1996). 6 S. Volltext nicht online. |
| Bechert, D. W. (1996) Rückstrombremsen. DLR-Interner Bericht. Internes Handout, DLR Berlin/TU Berlin. 4 S. Volltext nicht online. |
| Bechert, D. W. and Bruse, M. and Hage, W. (1996) VW-Stiftungsvorhaben I/69667+69668; Einige Aspekte der strömungsmechanischen Widerstandsverminderung in der Biologie. Projektteil: Verminderung der Wandreibung. Zwischenbericht 1995/96. DLR-Interner Bericht. 92517-96/B5. 28 S. Volltext nicht online. |
| Bechert, D. W. and Hage, W. and Bruse, M. (1995) Drag Reduction with the Slip Wall. AIAA Journal, Vol. 34 (2). Volltext nicht online. |
| Bechert, D. W. and Hage, W. and Bruse, M. (1996) Drag reduction with the slip wall. AIAA Journal, Vol. 34 (5), pp. 1072-1074. Volltext nicht online. |
| Bechert, D. W. and Meyer, R. and Hage, W. (1996) BMBF-Vorhaben 13N6537-8. Aeroflexible Oberflächenklappen als "Rückstrombremsen" nach dem Vorbild der Deckfedern des Vogelflügels. Zwischenbericht 1995. DLR-Interner Bericht. 92517-96/B12. 22 S. Volltext nicht online. |
| Bechert, D.W. (1997) On Loss reduction in axial turbomachines. Airforce Aero Propulsion Lab., Wright-Patterson AFB, Dayton, Ohio, USA, 7.7.1997. Volltext nicht online. |
| Bechert, D.W. (1997) Biological Surfaces - Laboratory and flight experiments on drag reduction and separation control. University of Southern California, Los Angeles, USA, 20.11.97. Volltext nicht online. |
| Bechert, D.W. and Bruse, M. and Hage, W. and Meyer, R. (1997) Biological surfaces and their technological application - laboratory and flight experiments on drag reduction and separation control. Invited Lecture. 4th AIAA Shear Flow Conference, 29.6.1997-2.7.1997, Snowmass Village, Co, USA. Volltext nicht online. |
| Bechert, D.W. and Bruse, M. and Meyer, R. (1997) Einige Aspekte der strömungsmechanischen Widerstandsverminderung in der Biologie. VW-Stiftung, Zwischenbericht 1996/97. DLR-Interner Bericht. 92517-97/B7. 12 S. Volltext nicht online. |
| Becker, J. (1999) Plain jet in crossflow at elevated pressure without and with filmer plate. Project Report, DLR-Interner Bericht. 325-01-99. Volltext nicht online. |
| Becker, J. (2000) Dispersion of a Plain Jet Spray of Kerosene in an Annular Swirling Air Flow at Elevated Temperature and Pressure. Project Report, DLR-Interner Bericht. 325-02-2000. 86 S. Volltext nicht online. |
| Becker, J. (2003) Characterization of the temporal and spatial homogeneity of the fuel placement in a swirl cup: Non-reacting flow investigation by light sheet imaging, LDA and PDA. Project Report, DLR-Interner Bericht. 325-03-03. 67 S. Volltext nicht online. |
| Becker, J. and Hassa, C. (1999) Breakup and Atomization of a Kerosene Jet in Crossflow of Air at Elevated Pressure. ILASS Europe 99, Proceedings 15th Annual Conference on Liquid Atomization and Spray Systems, Toulouse, Frankreich, 5.-7. Juli 1999. Volltext nicht online. |
| Becker, J. and Hassa, C. (2001) Messung des turbulenten Längenmaßes in einem generischen Vormischmodul für Flugtriebwerke. In: Lasermethoden in der Strömungsmesstechnik, 25.1-25.7. Shaker Verlag, Aachen. 9. Fachtagung in der Strömungsmesstechnik, GALA 2001, Winterthur, 18.-20. Sept. 2001. Volltext nicht online. |
| Becker, J. and Hassa, C. (2000) Plain Jet Kerosene Injection Into High Temperature, High Pressure Crossflow With And Without Filmer Plate. 8th International Conference on Liquid Atomization and Spray Systems, ICLASS-2000, Pasadena, USA, 16-20 July, 2000. Volltext nicht online. |
| Becker, J. and Hassa, C. (2002) Breakup and atomization of a kerosene jet in crossflow at elevated pressure. Atomization and Sprays, 12 (1-3), pp. 49-67. Volltext nicht online. |
| Becker, J. and Hassa, C. (2003) Liquid fuel placement and mixing of generic aeroengine premix module at different operating conditions. Journal of Engineering for Gas Turbines and Power, 125 (4), pp. 901-908. Volltext nicht online. |
| Becker, J. and Hassa, C. (2002) Liquid fuel placement and mixing of a generic aeroengine premix module at different operating conditions, paper number GT-2002-30102. In: 2002 ASME Turbo Expo, June 3-6, 2002, Amsterdam, The Netherlands. ASME Turbo Expo 2002, Amsterdam, 3.-6. Juni 2002. Volltext nicht online. |
| Becker, J. and Heitz, D. and Hassa, C. (2001) Spray Dispersion in a Counter-Swirling Double Annular Airflow at Gas Turbine Conditions. 17th Annual Conference on Liquid Atomization and Spray Systems, ILASS-Europe 2001, Zürich, 2.-6. Sept. 2001. Volltext nicht online. |
| Becker, J. and Heitz, D. and Hassa, C. (2004) Spray dispersion in a counter-swirling double-annular airflow at gas turbine conditions. Atomization and Sprays, 14 (1), pp. 15-35. Volltext nicht online. |
| Becker, J. and Jarius, M. (2003) Validation rig geometry and operating and boundary conditions. Project Report. WP4-DLR-12M. EU-MOLECULES. Volltext nicht online. |
| Becker, J, and Hassa, C, (2004) GT2004-53524 Experimental investigation of spatial and temporal aspects of the liquid fuel placement in a swirl cup at elevated pressure. In: Proceedings of ASME Turbo Expo 2004, Power for Land, Sea and Air, June 14-17, 2004, Vienna, Austria. ASME Turbo Expo, Wien, 14.-17. Juni 2004, Wien, Österreich. ISBN 0-7918-3739-4. Volltext nicht online. |
| Behrendt, T. (1998) Kraftstoffaufbereitung. Kolloquium Triebwerkstechnologie, Bonn, 10.12.1998. Volltext nicht online. |
| Behrendt, T. (2003) Strömung und Verbrennung in einem neuen Düsenkonzept für die magere Vormischverbrennung in Fluggasturbinen. DLR-Forschungsbericht. 14. Dissertation. 145 S. Volltext nicht online. |
| Behrendt, T. (2004) Einsatzmöglichkeiten und Nutzen keramischer Brennkammerwände in Flugtriebwerken. DLR Werkstoff-Kolloquium, DLR Köln-Porz, 07.12.04. Volltext nicht online. |
| Behrendt, T. and Frodermann, M. and Hassa, C. and Heinze, J. and Lehmann, and Stursberg, K. (1999) KEROMIX-stabile, schadstoffarme Magerverbrennung. Vorhaben: Druckeinfluss auf die magere Stabilitätsgrenze. KEROMIX Abschlusskolloquium, Köln, 8. Juni 1999. Volltext nicht online. |
| Behrendt, T. and Frodermann, M. and Hassa, C. and Heinze, J. and Lehmann, and Stursberg, K. (1999) Optical Measurements of Spray Combustion in a Single Sector Combustor from a Practical Fuel Injector at Higher Pressures. Symposium on Gas Turbine Engine Combustion, Emissions and Alternative Fuels, Lisboa, Portugal, 12.-16. Okt. 99. Volltext nicht online. |
| Behrendt, T. and Hassa, C. (1996) Ein Pruefstand zur Untersuchung von Zerstaeuber-Duesen fuer Gasturbinen. In: Proc. Spray 96, 2. Workshop über Sprays, Erfassung von Sprühvorgängen und Techniken der Fluidzerstäubung, Bremen, 4.-5.6.96, 1, 1-. Spray 96, 2.Workshop über Sprays, Erfassung von Sprühvorgängen und Techniken der Fluidzerstäubung, 4.-5. Juni 1996, Uni Bremen. Volltext nicht online. |
| Behrendt, T. and Hassa, C. (1997) Untersuchung der Spraydynamik einer Einspritzduese fuer Fluggasturbinen unter atmosphaerischen und simulierten Druckbedingungen. In: Proc. 3. Workshop über Sprays, Erfassung von Sprühvorgängen und Techniken der Fluidzerstäubung (1997). 3. Workshop über Sprays, Erfassung von Sprühvorgängen und Techniken der Fluidzerstäubung, Hrsg. Koschel, Haidn, ISBN 3891000294. Volltext nicht online. |
| Behrendt, T. and Hassa, C. (1997) Investigation of the spray dynamics of aeroengine fuel injectors under atmospheric and simulated pressure conditions. 90. AGARD-PEP Symposium, Bruessel, Belgien, 1997. Volltext nicht online. |
| Behrendt, T. and Hassa, C. and Heinze, J. and Stursberg, K. (1999) Druckeinfluss auf die magere Stabilitätsgrenze. DLR-Interner Bericht. 325-08-99. 68 S. Volltext nicht online. |
| Behrendt, T. and Heinze, J. and Hassa, C. (2000) Optical measurements of the reacting two-phase flow in a realistic combustor at elevated pressures. In: 16th annual Conference on liquid Atomization and Spray Systems, IV4.1-IV.4.6. ILASS-Europe 2000, Darmstadt, 11.-13.Sept.2000. Volltext nicht online. |
| Behrendt, T. and Heinze, J. and Hassa, Ch. (2003) EXPERIMENTAL INVESTIGATION OF A NEW LPP INJECTOR CONCEPT FOR AERO ENGINES AT ELEVATED PRESSURES. In: Proc. of ASME Turbo Expo 2003, ISBN 0-7918-3671-1 Proc. of ASME Turbo Expo. ISBN 0-7918-3671-1. Volltext nicht online. |
| Bekemeyer, Philipp and Görtz, Stefan (2023) The SMARTfly-Project: Overview of DLR Activities for Advanced Modeling. Deutscher Luft- und Raumfahrtkongress 2023, Stuttgart, 2023-09-19 - 2023-09-21, Stuttgart. Volltext nicht online. |
| Bekemeyer, Philipp and Görtz, Stefan (2024) Schlussbericht zum "DLR-Beitrag Smart Modeling of flying Transport Vehicles" (SMARTfly), Entwicklung exakter und effizienter Modellierungen und Simulationsmethoden für den Entwurf von Fluggeräten und Triebwerken zum LuFo-VI-1-Verbund "DIGIfly". Project Report. Technische Informationsbibliothek (TIB) Hannover. 81 S. Volltext nicht frei. |
| Berg, H.P. and Hennecke, D.K. and Elfert, M. and Hein, O. (1991) The effect of rotation on local coolant side flow and heat transfer in turbine blades. In: ISABE-Paper 91-7016, Vol. 1, pp. 170-183. AIAA, American Institute of Aeronautics and Astronautics, Washington. Proceedings of the 10th International Symposium on Air Breathing Engines (ISABE), Nottingham (UK), 01.-06.09.1991. ISBN 1-56347-006-3. Volltext nicht online. |
| Bergmann, Michael and Morsbach, Christian and Ashcroft, Graham and Kügeler, Edmund (2021) Statistical Error Estimation Methods for Engineering-Relevant Quantities From Scale-Resolving Simulations. ASME Journal of Turbomachinery. American Society of Mechanical Engineers (ASME). doi: 10.1115/1.4052402. ISSN 0889-504X. |
| Bergmann, Michael and Morsbach, Christian and Ashcroft, Graham and Kügeler, Edmund (2021) Statistical Error Estimation Methods for Engineering-Relevant Quantities From Scale-Resolving Simulations (Presentation). 2nd High-Fidelity Industrial LES/DNS Symposium, 2021-09-22 - 2021-09-24, Online. Volltext nicht online. |
| Berthold, Christian (2024) Coupled simulation of turbomachinery flutter and forced response blade vibrations using nonlinear frequency domain methods. Dissertation, Universität Stuttgart. doi: 10.18419/opus-15456. Volltext nicht online. |
| Berthold, Christian and Frey, Christian (2022) COUPLED SIMULATION OF A SHROUDED TURBINE BLADE ROW WITH CONTACT FRICTION INTERFACES - ANALYSIS OF A LIMIT TORUS OSCILLATION. Proceedings of 16th International Symposium on Unsteady Aerodynamics, Aeroacoustics & Aeroelasticity of Turbomachines, 2022-09-19 - 2022-09-23, Toledo. |
| Berthold, Christian and Gross, Johann and Frey, Christian and Krack, Malte (2022) Fully Coupled Analysis of Flutter Induced Limit Cycles: Frequency vs. Time Domain Methods. In: ASME Turbo Expo 2022: Turbomachinery Technical Conference and Exposition, GT 2022. ASME 2022 Turbomachinery Technical Conference & Exposition, 2022-06-13 - 2022-06-17, Rotterdam. doi: 10.1115/GT2022-77999. ISBN 978-079188612-0. Volltext nicht online. |
| Berthold, Christian and Gross, Johann and Frey, Christian and Krack, Malte (2024) Fully coupled forced response analysis of nonlinear turbine blade vibrations in the frequency domain. Journal of Fluids and Structures, 127, p. 104112. Elsevier. doi: 10.1016/j.jfluidstructs.2024.104112. ISSN 0889-9746. Volltext nicht online. |
| Beversdorff, M. and Foerster, W. and Clauss, W. and Waidmann, W. and Woyde, M. (1997) Velocity and Temperature Measurements in a Scramjet Combustion Chamber. In: Proc. XIII Int. Symp. on Air Breathing Engines (ISABE) 1997. XIII International Symposium on Air Breathing Engines (ISOABE). Volltext nicht online. |
| Beversdorff, M. and Foerster, W. and Rymenants, E. and Schodl, R. (1994) Laser Two Focus Velocimetry Applied to TsAGI's Supersonic Combustor Test Rig T131. DLR-Interner Bericht. 325-07-94. Volltext nicht online. |
| Beversdorff, M. and Foerster, W. and Schodl, R. (1994) Inflight measurements in a Citation Airplane with a Diode-L2F. DLR-ONERA-Messtechni-Kooperation, Treffen in Lampoldshausen. Volltext nicht online. |
| Beversdorff, M. and Foerster, W. and Schodl, R. and Jentink, H.W. (NLR) (1997) In-flight Laser Anemometry for Aerodynamic Investigations on an Aircraft. OPTICS and LASERS in Engineering, 6, pp. 571-586. Elsevier, Northern Ireland. Volltext nicht online. |
| Beversdorff, M. and Förster, W. and Schodl, R. and Jentink, H.W. (1998) Laser-Anemometrie im Flugversuch. 1. Braunschweiger Symposium für Flugmeßtechnik des SFB 420, TU Braunschweig, 31.03.-01.04.1998. Volltext nicht online. |
| Beversdorff, M. and Förster, W. and Schodl, R. and Jentink, H.W. (1998) Laser Anemometrie im Flugversuch. 1. Braunschweiger Symposium für Flugmesstechnik, SFB 420,Uni Braunschweig, 31.03.-01.04.1998. Volltext nicht online. |
| Beversdorff, M. and Klemmer, T. and Rymenants, E. and Schodl, R. (1994) L2F-Geschwindigkeitsmessungen am Austritt einer H2-luftbetriebenen Brennkammer. DLR-Interner Bericht. 325-05-94. Volltext nicht online. |
| Beversdorff, M. and Matziol, L. and Blaha, C. (1997) Application of 3D-Laser Two Focus Velocimetry in Turbomachine Investigations. 90th Symposium of AGARD-PEP on "Advanced non-intrusive Instrumentation for Propulsion Engines, Oct. 20-24, Bruessel, 1997. Volltext nicht online. |
| Beversdorff, M. and Heinrich, R. and Schodl, R. (1992) An L2F-Measurement Device with Image Rotator Prism for Flow Velocity Analysis in Rotating Coolant Channels. In: AGARD-PEP. 80th Symposium of the PEP on "Heat Transfer and Cooling in Gas Turbines", 1992-10-12 - 1992-10-16, Antalya, Turkey. Volltext nicht online. |
| Bhayaraju, U. and Giuliani, F. and Hassa, C. (2004) Study of Prefilming Airblast Atomisation at High Pressure Conditions. DLR/ONERA Annex II Meeting, Köln, 6.-7. 4. 2004,. Volltext nicht online. |
| Blandeau, V. and Pastorelli, V. and Moreau, A. and Guérin, S. (2015) Fan noise scaling of static data using semi-analytical methods and assessment against experimental data. In: 21st AIAA/CEAS Aeroacoustics Conference, 2015. 21st AIAA/CEAS Aeroacoustics Conference, AVIATION 2015, 2015-06-22 - 2015-06-26, Dallas. doi: 10.2514/6.2015-2517. Volltext nicht online. |
| Bluemcke, E. and Brandt, M. and Eickhoff, H. (1991) Particle Dispersion in Highly Swirling Turbulent Flows. Eighth Symposium on turbulent shear flows, 9.-11.09.1991 Technische Universität München. Volltext nicht online. |
| Bluemcke, E. and Brandt, M. and Eickhoff, H. and Hassa, Ch. (1992) Experimental and Theoretical Investigation of a Research Atomizer Combustion Chamber Configuration. In: ASME International Gas Turbine Conference 1992, paper 137. ASME, New York, USA. Volltext nicht online. |
| Bluemcke, E. and Brandt, M. and Eickhoff, H. and Hassa, Ch. (1993) Validation Experiments for Dispersed Phase Modelling in Combusting Flows. 6th Workshop on Two-Phase-Flow Predictions, edition M. Sommerfeld. Volltext nicht online. |
| Blümcke, E. (1990) Simulation der turbulenten Partikeldispersion in brennkammertypischen Drallströmungen. Kolloquium Energietechnik, Ruhr-Universität Bochum, 1990. Volltext nicht online. |
| Blümcke, E. and Brandt, M. and Eickhoff, H. and Hassa, C. (1993) Particle Dispersion in Highly Swirling Turbulent Flows. Particle and Particle System Characterization, 10, pp. 182-190. Volltext nicht online. |
| Blümcke, E. and Eickhoff, H. and Hassa, C. (1990) Evaluation of a Spectral Dispersion Model with Experimental Results. 5th Workshop on 2 Phase-Flow Predictions, Universitaet Erlangen, March 1990.. Volltext nicht online. |
| Blümcke, E. and Eickhoff, H. and Hassa, C. (1990) Evaluation of a Spectral Dispersion Model with Experimental Results Obtained from the Dispersion of Monosized Droplets in a Turbulent Swirling Flow. In: Proceedings of the 5th Workshop on Two-Phase Flow Predictions. 5th Workshop on Two-Phase Flow Predictions, 1990. Volltext nicht online. |
| Blümcke, W. (1992) Turbulente Partikeldispersion in eingeschlossenen Drallströmungen. DLR-Forschungsbericht. 92-32. Dissertation. 178 S. Volltext nicht online. |
| Boetzer, Michael (2011) Experimentelle Untersuchungen des Strömungsfeldes einer HDT-Stufe zum Einfluss von beschädigten Statorschaufeln auf den Stufenwirkungsgrad. DLR-Interner Bericht. DLR-IB 225 - 2011 C 04. Diploma. Institut für Antriebstechnik. 89 S. Volltext nicht online. |
| Bonneau, Gaetan (2019) Numerical Investigation of the Heat Transfer and the Flow Characteristics of a Cooled Turbine End Wall. Other, Ensiame / DLR Institut für Antriebstechnik. Volltext nicht frei. |
| Bosen, S. (1991) Experimentelle Erprobung von Flüssigkristallbeschichtungen zur Untersuchung des Grenzschichtumschlages auf der Oberfläche transsonischer Verdichterprofile. DLR-Interner Bericht. 325-05-91. 115 S. Volltext nicht online. |
| Brabender, F. (1991) Strömungsmessung mit Hilfe eines Laser-Anemometers in einem rotierenden Modellkanal. DLR-Interner Bericht. 325-03-91. 98 S. Volltext nicht online. |
| Brakmann, Robin (2025) Towards Climate-Compatible Propulsion. Lecture Frontiers in Aeronautics („Guestlecture DLR“), 2025-05-08, Emden, Deutschland. (Unpublished) Volltext nicht frei. |
| Brandt, M. (1990) Messung der Geschwindigkeit, Konzentration und Ankunftszeitenverteilung monodisperser Tropfen in einer turbulenten Drallstroemung mit der Laser-Doppler-Anemometrie. Diploma. Volltext nicht online. |
| Brandt, M. (1994) First Measurements on an Evaporating Spray at Elevated Pressure. Vortrag am 9. Juni 1994, Universitaet Patras, Griechenland, innerhalb des BRITE/EURAM-Low Emissions Combustor Technology Programme-Phase II. Volltext nicht online. |
| Brandt, M. (1995) Two Phase Flow in Rectangular High Pressure Duct. Vortrag am 06.12.1994, Universitaet Karlsruhe innerhalb des BRITE/ EURAM - Low Emissions Combustor Technology Programme-Phase II. Volltext nicht online. |
| Brandt, M. (1995) The Influence of Air Pressure, Temperature and Fuel Loading Ratio an Liquid Fuel Evaporation. Brite/Euram-Low Emission Combustor Technology Program-Phase II, ENSMA-Futoroscope Poitiers, Frankreich, 14.06.1995. Volltext nicht online. |
| Brandt, M. (1995) Messung der Zwei-Phasen-Stroemung in einer Oelmischvorstrecke. Vortrag am 10.03.95, Hotel du Porc, Baden, Schweiz, innerhalb des Arbeitskreises TURBOFLAM. Volltext nicht online. |
| Brandt, M. (1995) Liquid and Gaseous Fuel Measurements in a Premix Duct. In: Proc. of the 11th European Conference of ILASS Europe on Atomization and Sprays, Nürnberg 1995, pp. 33-42. Nürnberg Messe GmbH. European Conference of ILASS Europe on Atomization and Sprays, Nürnberg 1995. ISBN 3-921590-34-5. Volltext nicht online. |
| Brandt, M. (1995) Messung der Zwei-Phasen Stroemung in einer Oelmischvorstrecke. Vortrag in der AG-Turbo TURBOFLAM am 25. Okt. 1995, DLR, Koeln-Porz. Volltext nicht online. |
| Brandt, M. (1996) The task summary of the DLR in Theme III: Focused Generics. Vortrag in Villa Roche, Frankreich, 6.02.1996 im Rahmen des CEC Low Emissions Technology Programme : Low NOx III. Volltext nicht online. |
| Brandt, M. (1995) The Influence of Turbulence Generators on Liquid Fuel Evaporation in a Premix Duct. Dahlewitz (BMW-RR), 12. Dez. 1995 im Rahmen des CEC-Brite Euram Low Emissions Combustor Technology-Phase II. Volltext nicht online. |
| Brandt, M. (1996) Messung der Zwei-Phasen Stroemung in einer Oelmischvorstrecke (III). Vortrag AG Turbo TURBOFLAM, Arbeitskreissitzung am 27.03.96, Muelheim, Siemens-KWU. Volltext nicht online. |
| Brandt, M. (1996) Two-Phase Flow in Rectangular High Pressure Ducts. Final Report. Vortrag am 14.05.96, Rolls-Royce, Derby UK, innerhalb BRITE EURAM. Volltext nicht online. |
| Brandt, M. (1996) Experimentelle Untersuchung der Zwei-Phasen-Strömung in einem Vormischkanal für die magere vorverdampfte Verbrennung. Vortrag am 27.11.96 im Kolloquium Energietechnik der Ruhr-Universität Bochum. Volltext nicht online. |
| Brandt, M. and Eickhoff, H. and Hassa, Ch. (1992) An Experimental Study of Spray-Gasphase Interaction for a Co-Swirling Airblast Atomizer. In: 8th Annual Conference of the European ILASS, pp. 115-122. Shell, Amsterdam, Netherlands. Volltext nicht online. |
| Brandt, M. and Gugel, K.O. and Hassa, C. (1997) Experimental Investigation of the Liquid fuel Evaporation in a Premix Duct for Lean Premixed and Prevaporized Combustion. Trans. ASME, 5. Eng. Gas Turbines and Power, 119. Volltext nicht online. |
| Brandt, M. and Gugel, K.O. and Hassa, C. (1997) Experimental Investigation of the Liquid Fuel Evaporation in a Premix Duct for Lean Premixed and Prevaporized Combustion. Journal of Engineering for Gas Turbines and Power, 119, pp. 815-821. Volltext nicht online. |
| Brandt, M. and Hassa, C. (1994) Messung der Zweiphasenströmung in einer Ölmischvorstrecke. Turboflam Arbeitskreissitzung Dresden, 06.10.1994. Volltext nicht online. |
| Brandt, M. and Hassa, C. (1996) Task 2.1.5 "Two Phase Flow in High Pressure Duct". Project Report, DLR-Interner Bericht. BRITE/EURAM 'Low Emissions Combustor Technology' Phase II, Subtask 2.15, Final Report CEL Contract No.: AERO-Ctal-0036. 63 S. Volltext nicht online. |
| Brandt, M. and Hassa, C. (1996) Modification of High Pressure Rig for Air-Fuel Mixing Experiments. Minutes of Expert Group Meeting "Focused Generic Combustion" BRITE/ EURAM Low Emissions Combustion III. Volltext nicht online. |
| Brandt, M. and Hassa, C. (1996) Two Phase Flow in High Pressure Duct. Project Report, DLR-Interner Bericht. 64 S. Volltext nicht online. |
| Brandt, M. and Hassa, C. and Kallergis, K. and Eickhoff, K. (1994) An Experimental Study of Fuel Injectors for Premixing Ducts. Begell House, Inc., 79 Madison Avenue, NY 10016, USA. Proceedings of the 6th International Conference on Liquid Atomization and Spray Systems, ICLASS 1994, July 19-22, 1994 Rouen. Volltext nicht online. |
| Brandt, M. and Hassa, C. and Rachner, M. (1997) Messung der Zwei-Phasen-Strömung (Tropfengeschwindigkeit und -größe) in einer Ölvormischstrecke. Project Report, DLR-Interner Bericht. Abschlußbericht zum TURBOFLAM II-Vorhaben 3.2.1.8. 72 S. Volltext nicht online. |
| Brandt, M. and Hassa, Ch. and Kneer, R. and Lisiecki, D. and Tam, I. and Ledoux, M. and Cormack, G. and Hawkins, H.L. and Zasuja, A.K. (1992) Cross Correlation of Three Drop Sizing Techniques. In: 6th Int. Symp. on Appl. of Laser Techniques to Fluid Mechanics. Ladoan, Lisboa, Portugal. Volltext nicht online. |
| Brandt, M. and Heeren, A. and Eckart, D. and Kremer, H. and Ridder, M. and Sick, V. (1997) A Laser-based Study of Kerosine Evaporation and Mixing in a Premix Duct for Gas Turbines at Elevated Pressures. Laser Anemometry Advances and Applications, 7th Int. Conference, September 8-11, 1997. Volltext nicht online. |
| Brandt, M. and Rachner, M. and Schmitz, G. (1998) An experimental and numerical study of kerosine spray evaporation in a premix duct for gas turbine Combustors at high pressure. Combustion Science and Technology, Vol 138 (1-6), pp. 313-348. Volltext nicht online. |
| Brotzeller, K. (2003) Periodisches / transientes Verfahren zur Bestimmung von Wärmeübergangskoeffizienten. DLR-Interner Bericht. 225-2003 A 04. 75 S. Volltext nicht online. |
| Brunner, B. and Deidewig, F. and Doepelheuer, A. and Lecht, M. and Lenic, J. and Schmitt, A. (1997) Die zeitliche Entwicklung der Verteilung der Luftverkehrsemissionen. Project Report, DLR-Interner Bericht. Zwischenbericht, BMBF 01LL 9502/0. 32 S. Volltext nicht online. |
| Brunner, B. and Lenic, J. and Schmitt, A. and Deidewig, F. and Döpelheuer, A. and Lecht, M. (1998) Die zeitliche Entwicklung der Verteilung der Luftverkehrsemissionen. Project Report. 01 LL 9502/0. BMBF. Volltext nicht online. |
| Bruse, M. and Bechert, D. W. and Hage, E. and Hoppe, G. and van der Hoeven, J. G. (1996) Der Hai, und was daraus werden kann. Widerstandsvermindernde Oberflächen (riblets). Seminar für Strömungsmechanik, TU Berlin, 29.11.1996. Volltext nicht online. |
| Bruse, M. and Bechert, D. W. and Hage, W. (1995) Shark Skin: Mechanism and Application. Invited Talk on Biomimetics and Bionics. St. Andrews Meeting of the Society for Experimental Biology, St. Andrews/Scotland, 3-7 April 1995. Volltext nicht online. |
| Bruse, M. and Bechert, D. W. and Hage, W. (1995) Experiments with 3D and 2D Riblets and with the Slip Wall. Euromech Colloquium 332 - "Drag Reduction". 9th European Drag Reduction Meeting, Ravello/Italy, 19-21 April 1995. Volltext nicht online. |
| Bruse, M. and Bechert, D. W. and Hage, W. (1996) Fluid mechanics of the shark skin and its technical application. XIXth International Congress of Theoretical and Applied Mechanics, Kyoto, Japan, 25-31 August 1996. Volltext nicht online. |
| Bruse, M. and Bechert, D.W. and Hage, W. (1997) Velocity measurements over a riblet structured surface with hot-film probes. Euromech 3rd European Fluid Mechanics Conference 1997, September 1997, Göttingen. Volltext nicht online. |
| Buchmann, N. A. and Willert, C. and Soria, J. (2011) Tomographic Particle Image Velocimetry using Pulsed, High Power LED Volume Illumination. 9th International Symposium on Particle Image Velocimetry – PIV’11, 2011-07-21 - 2011-07-23, Kobe, Japan. |
| Buchmann, Nicolas A. and Willert, Christian and Soria, Julio (2010) Pulsed, high-power LED volume illumination for tomographic particle image velocimetry. 17th Australasian Fluid Mechanics Conference (AFMC), 2010-12-05 - 2010-12-09, Auckland, New Zealand. Volltext nicht frei. |
| Buske, Clemens and Richter, Christoph and Thiele, Frank and Yu, Chao and Zhuang, Mei (2010) Validation of a Zonal Approach Computing the Sound Radiation from Lined Ducts. AIAA Journal, Vol. 48 (No. 12), pp. 2899-2908. American Institute of Aeronautics and Astronautics (AIAA). doi: 10.2514/1.J050478. Volltext nicht online. |
| Böhm, Jonas and Bachner, Johannes Ricco and Brakmann, Robin (2020) Numerische Untersuchung eines Freistrahls in einem Sondenkalibrierkanal. Bachelor's, Ostfalia Hochschule für angewandte Wissenschaften. |
| Carl, M. (1997) Inbetriebnahme des Hochdruckbrennkammerprüfstandes - Gläserne Brennkammer -. E3E-Workshop NOx-Reduktion durch Homogenisierung des Gemisches in Brennkammern, München, 23.-24.10. 1997. Volltext nicht online. |
| Carl, M. (1997) Betrieb des Hochdruck-Komponentenprüfstands. E3E Workshop, BRR, Dahlewitz, 4.-5.12.1997. Volltext nicht online. |
| Carl, M. (2003) Ergebnisse der Teilvorhaben des DLR mit Rolls-Royce Deutschland und MTU im Rahmen des Forschungsvorhabens Engine 3E. Project Report, DLR-Interner Bericht. 325-09-03. 191 S. Volltext nicht online. |
| Carl, M. (1996) Umbau- und Inbetriebnahme des Hochdruckbrennkammer-Pruefstandes - Glaeserne Brennkammer. 1. Workshop d. MTU-Engine 3E-Brennkammertechnologieprog.NOx-Reduktion durch Homogenisierung d. Gemisches in Brennkammern, MTU, 22.10.1996. Volltext nicht online. |
| Carl, M. and Behrendt, T. and Fleing, C. and Frodermann, M. and Heinze, J. and Hassa, C. and Meier, U. and Wolff-Gaßmann, D. and Hohmann, S. and Zarzalis, N. (2000) Experimental and Numerical Investigations of a Planar Combustor Sector at Realistic Operating Conditions. In: ASME TURBO EXPO 2000. ASME TURBO EXPO 2000: Land, Sea and Air, Munich, Germany, 8-11 May, 2000. Volltext nicht online. |
| Carl, M. and Behrendt, T. and Fleing, C. and Frodermann, M. and Heinze, J. and Hassa, C. and Meier, U. and Wolff-Gaßmann, D. and Hohmann, S. and Zarzalis, N. (2001) Experimental and Numerical Investigation of a Planar Combustor Sector at Realistic Operating Conditions. Transactions of the ASME - A - Engineering for Gas Turbines and Power, 123 (4), pp. 810-816. Volltext nicht online. |
| Carl, M. and Behrendt, T. and Fleing, C. and Frodermann, M. and Heinze, J. and Röhle, I. and Hassa, C. and Lückerath, R. and Meier, U. and Schneider-Kühnle, Y. and Wolff-Gaßmann, D. and Laible, C. and Ziegler, M. (1999) Experimentelle und numerische Untersuchung der Verbrennung im ebenen Sektor einer gestuften Brennkammer bei realistischen Betriebsbedingungen. In: Luft- und Raumfahrt vor dem neuen Jahrtausend, DGLR-JT99-188. DGLR,Bonn,Deutschland. DGLR Jahrestagung, Berlin, 27.-30.09.1999. Volltext nicht online. |
| Carl, M. and Frodermann, M. and Behrendt, T. and Heinze, J. and Röhle, I. and Hassa, C. and Brehm, N. and Schilling, T. and Doerr, T. (1998) Experimental Investigations of an Axially Staged Combustor Sector with Optical Diagnostics at Realistic Operating Conditions. In: RTO Meeting Proceedings 14, Gas Turbine Engine Combustion, Emissions and Alternative Fuels, RTO-MP-14, 18-1-18-11. Canada Communication Group Inc.. RTO Symposium, Lisboa, Portugal, 12.-16.10.,1998. ISBN 92-837-0009-0. Volltext nicht online. |
| Carrarini, A. (2000) Strömungsmechanische Effekte in der Mehrkörpersimulation bodengebundener Fahrzeuge. DLR-Interner Bericht. 532-00-04. 43 S. Volltext nicht online. |
| Carvalho, Francisco and Wehrel, Patrick and Matuschek, Tomasz and Schöffler, Robin and Brakmann, Robin and Behrendt, Thomas and Ebel, Paul-Benjamin and Schulz, Uwe and Herbst, Florian (2025) Pre-Design and Analysis of a Military Hybrid High-Pressure Turbine. In: 70th ASME Turbo Expo 2025: Turbomachinery Technical Conference and Exposition, GT 2025. ASME Turbo Expo 2025, 2025-06-16 - 2025-06-20, Memphis, USA. doi: 10.1115/GT2025-151307. Volltext nicht online. |
| Carvalho, Francisco and Wehrel, Patrick and Matuschek, Tomasz and Schöffler, Robin and Brakmann, Robin and Behrendt, Thomas and Ebel, Paul-Benjamin and Schulz, Uwe and Herbst, Florian (2025) Pre-Design and Analysis of a Military Hybrid High-Pressure Turbine. Journal of Engineering for Gas Turbines and Power. American Society of Mechanical Engineers (ASME). doi: 10.1115/1.4069736. ISSN 0742-4795. Volltext nicht online. |
| Ch. Resag, R. Schodl (1992) Theoretische und experimentelle Untersuchungen zur Auslegung ei- ner Lichtschnittsonde fuer die Sichtbarmachung von Stofronten in transsonischen Stroemungen. Other. SM-AT. 65 S. Volltext nicht online. |
| Charroin, Guillaume (2022) Validation of the CFD simulation of a contrarotating fan with experimental data. Master's, Universite Polytechnique INSA Hauts-de-France. Volltext nicht online. |
| Cheishvili, Konstantine (2016) Development and Validation of an End-to-End Simulator for Frequency Scanning Filtered Rayleigh Scattering Techniques. Master's, TU Delft. |
| Cherednichenko, Svetlana and Frey, Christian and Ashcroft, Graham (2012) On the Application of the Discontinuous Galerkin Method to Turbomachinery Flows. In: 6th European Congress on Computational Methods in Applied Sciences and Engineering, pp. 2359-2375. ECCOMAS 2012, 2012-09-10 - 2012-09-14, Vienna, Austria. ISBN 978-3-9502481-9-7. |
| Dahlmann, Katrin and Grewe, Volker and Matthes, Sigrun and Frömming, Christine and Hendricks, Johannes and Linke, Florian and Plohr, Martin and Righi, Mattia and Schripp, Tobias and Sauer, Daniel and Kaufmann, Stefan and Voigt, Christiane and Weder, Christian Martin and Mertens, Mariano and Brinkop, Sabine and Unterstrasser, Simon (2022) Eco2Fly - Towards an aviation climate impact assessment. TAC-5 Conference 2022, 2022-06-27 - 2022-06-30, Bad Aibling. Volltext nicht online. |
| Dahlmann, Katrin and Koch, Alexander and Linke, Florian and Grewe, Volker and Otten, Tom and Seider, Doreen and Gollnick, Volker and Schumann, Ulrich (2016) Climate-Compatible Air Transport System - Climate Impact Mitigation Potential for Actual and Future Aircraft. Aerospace, pp. 1-25. Multidisciplinary Digital Publishing Institute (MDPI). doi: 10.3390/aerospace3040038. ISSN 2226-4310. |
| Dahlmann, Katrin and Niklaß, Malte and Grewe, Volker and Linke, Florian and Maertens, Sven and Matthes, Sigrun and Plohr, Martin and Scheelhaase, Janina and Wozny, Florian (2022) Testing of a Monitoring Reporting & Verification (MRV) Scheme for non-CO2 aviation effects. Workshop on aviation non-CO2 : focus on flight routing initiatives in the EU, 2022-01-12, Online. Volltext nicht frei. |
| Dahlmann, Katrin and Plohr, Martin and Niklaß, Malte and Grewe, Volker and Gutt, Ekkehard and Katzer, M. and Kluge, M. and Lau, Alexander and Linke, Florian and Maertens, Sven and Matthes, Sigrun and Scheelhaase, Janina and Wozny, Florian (2022) Inclusion of non-CO2 effects of aviation in the EU ETS: Testing of a Monitoring Reporting & Verification (MRV) Scheme for non-CO2 aviation effects. Discussion with members of the EU Parlianment, 2022-02-11, Online. Volltext nicht frei. |
| Dannemann, Martin and Kucher, Michael and Kunze, Eckhart and Modler, Nils and Knobloch, Karsten and Enghardt, Lars and Sarradj, Ennes and Höschler, Klaus (2018) Experimental Study of Advanced Helmholtz Resonator Liners with Increased Acoustic Performance by Utilising Material Damping Effects. Applied Sciences, 8 (10), p. 1923. Multidisciplinary Digital Publishing Institute (MDPI). doi: 10.3390/app8101923. ISSN 2076-3417. |
| Deick, A. (1993) Messung und Beurteilung des Geschwindigkeits- und Temperaturfeldes sowie der Abgaszusammensetzung einer Brennkammerkonfiguration mit Luftstromzerstaeuber. Diploma. Volltext nicht online. |
| Deidewig, F. (1991) Ein Beitrag zur Berechnung von Einstrom-Turboluftstrahltriebwerken (TL) und Zweistrom-Turboluftstrahltriebwerken (ZTL). DLR-Interner Bericht. 325-12-91. 83 S. Volltext nicht online. |
| Deidewig, F. (1994) Emissionen aus Verkehrsflugzeugen und Methoden zur Emissionsverminderung. 1. DFG-Schwerpunkt "Grundlagen der Auswirkungen der Luft- und Raumfahrt auf die Atmosphäre, DFG-Kolloquium, München, 19.04.93. Volltext nicht online. |
| Deidewig, F. (1994) Leistungsanalyse ziviler Zweistromtriebwerke unter Beruecksichtigung der emittierten Schadstoffe. TU Berlin, 26.11.93. Volltext nicht online. |
| Deidewig, F. (1993) Thermodynamische Teillastrechnungen gemischter und ungemischter ZTL-Triebwerke bei Beruecksichtigung variabler Geometrien. DLR-Interner Bericht. 325-04-93. 25 S. Volltext nicht online. |
| Deidewig, F. (1994) Aircraft Emission - Thermodynamical Engine Performance Codes. ECAC /ANCAT Emissions Inventory Database Group 10.Febr. 1994 Department of Trade and Industry, London, UK. Volltext nicht online. |
| Deidewig, F. (1995) Studies on NOx-Emissions of SST Engine Concepts. Vortrag 86.AGARD Tagung in Seattle, 25.09.-29.09.95, USA. Volltext nicht online. |
| Deidewig, F. (1996) Potentiale alternativer Antriebskonzepte gegenueber dem Olympus-Triebwerk der Concorde. Ueberschallflugverkehr Lufthansa Frankfurt, Jan. 1996. Volltext nicht online. |
| Deidewig, F. (1998) Ermittlung der Schadstoffemissionen im Unter- und Überschallflug. DLR-Forschungsbericht. 98-10. Dissertation. 174 S. Volltext nicht online. |
| Deidewig, F. and Doepelheuer, A. (1995) Studies on NOx-Emissions of SSt Engine Concepts. AGARD, Neuilly-sur-Seine, Frankreich. Volltext nicht online. |
| Deidewig, F. and Doepelheuer, A. and Lecht, M. (1995) Überprüfung und Weiterentwicklung von Schadstoff-Korrelationen auf Höhenflugzustände. Project Report, DLR-Interner Bericht. 23 S. Volltext nicht online. |
| Deidewig, F. and Doepelheuer, A. and Lecht, M. (1995) Abschlußbericht zum Forschungsvorhaben "Überprüfung und Weiterentwicklung von Schadstoffkorrelationen auf Höhenflugzustände. Project Report, DLR-Interner Bericht. 65 S. Volltext nicht online. |
| Deidewig, F. and Doepelheuer, A. and Lecht, M. (1996) Methods to Assess Aircraft Engine Emissions in Flight. 20th Congress of the Int. Council of the Aeronautical Sciences 1996 (ICAS), 8-13 Sept. 1996, Sorrent, Italien. Volltext nicht online. |
| Deidewig, F. and Döpelheuer, A. and Lecht, M. (1994) Leistungs- und Emissionsverhalten zukünftiger Überschalltriebwerke. In: DGLR-Jahrbuch 1994. DGLR, Deutsche Gesellsch. f. Luft-u. Raumfahrt, Bonn. Volltext nicht online. |
| Deidewig, F. and Lecht, M. (1994) Estimates for NOx-Emissions in Flight with a Minimum of Aircraft and Engine Data. ICAO/CAEP, WG 3 Certification/Technology Subgroup, 05.-07.05.93, Ottawa, Canada. Volltext nicht online. |
| Deidewig, F. and Lecht, M. (1994) Ueberpruefung und Weiterentwicklung von Schadstoffkorrelationen auf Hoehenflugzustaende. Project Report, DLR-Interner Bericht. 87 S. Volltext nicht online. |
| Deidewig, F. and Lecht, M. (1996) Ermittlung der von Flugzeugen waehrend typischer Flugmissionen emittierten Schadstoffmengen auf die Atmosphäre. Poster zum Abschlusskolloquium, DFG Schwerpunkt Grundlagen der Auswirkung d. Luft-u.Raumfahrt auf die Atmosphaere, 11./12.12.96, DLR. Volltext nicht online. |
| Deidewig, F. (1992) Schadstoffemissionen ziviler Flugtriebwerke am Beispiel des CFM56-3 und CSF-80C2. DLR-Interner Bericht. 325-04-92. SM-AT. 89 S. Volltext nicht online. |
| Diers, O. and Behrendt, T. and Cordes, S. and Fischer, M. and Koopman, J. and Hassa, C. (1999) Large Engines Combustor Demonstrator - Technology Demonstration - Investigation of First Advanced Cooling Mixing Concept. Project Report, DLR-Interner Bericht. 325-07-99. 52 S. Volltext nicht online. |
| Diers, O. and Giuliani, F. and Biscos, Y. and Gajan, P. and Ledoux, M. (2001) Phasenaufgelöste LDA-Messungen in der Gasströmung einer Luftstromzerstäuberdüse. In: Lasermethoden in der Strömungsmesstechnik, 36.1-36.7. Shaker Verlag, Aachen, Deutschlang. 9. Fachtagung Lasermethoden in der Strömungsmesstechnik, GALA,Winterthur, Schweiz, September 2001. ISBN 3-8265-9214-x. Volltext nicht online. |
| Diers, O. and Hassa, C. (2005) Experimentelle Analyse der Brennkammerschwingungen, Vorhaben 4.4.1. Project Report, DLR-Interner Bericht. 325-07-05. 50 S. Volltext nicht online. |
| Diers, O. and Koopman, J. and Fischer, M. and Hassa, C. (2001) Investigation of two advanced cooling mixing concepts for a rich quench lean combustor. In: ASME Turbo Expo 2001, pp. 1-8. ASME Turbo Expo 2001, New Orleans, USA, June 4-8, 2001. Volltext nicht online. |
| Diers, O. and Koopman, J. and Hassa, C. (2000) Large Engines Combustor Demonstrator - Technology Demonstration - Investigation of Second Advanced Cooling Mixing Concept. Project Report, DLR-Interner Bericht. 325-03-2000. 64 S. Volltext nicht online. |
| Diers, Olaf and Heinze, Johannes and Hassa, Christoph and Giezendanner-Thoben, Robert (2005) Thermoakustisches Verhalten eines Gasturbinenbrenners realer Größe in einer akustisch abstimmbaren Brennkammer. In: VDI-Berichte, 1888, pp. 195-206. VDI Verlag Düsseldorf. 22. deutscher Flammentag, 2005-09-21 - 2005-09-22, Braunschweig. Volltext nicht online. |
| Dietz, O. and Fidora, F. (1994) Auslegung eines Keildiffusors fuer Ueberschallstroemungen. Other. 190 S. Volltext nicht online. |
| Dingel, O. and Seidel, T. and Schodl, R. and Willert, C. (2002) Messung der Zylinderinnenströmung mit Doppler Global Velocimetry. Proceedings der HdT-Tagung: Optisches Indizieren - Verbrennungsentwicklung für Otto- und Dieselmotoren, Essen, 14. Nov., 2002.. Volltext nicht online. |
| Doepelheuer, A. (1998) Influence of engine performance on emission characteristics. RTO/AVT Symposium on "Gas Turbine Combustion, Emissions and Alternative Fuels", Lisboa, Portugal, 12.-16. Oct. 1998. Volltext nicht online. |
| Doepelheuer, A. (1994) Abschaetzung des Brennstoffverbrauchs und der NOx-Emission von Ueberschallverkehrsflugzeugen. DLR-Interner Bericht. 325-13-94. 160 S. Volltext nicht online. |
| Doepelheuer, A. (1997) Berechnung der Produkte unvollständiger Verbrennung aus Luftfahrttriebwerken. DLR-Interner Bericht. 325-09-97. 38 S. Volltext nicht online. |
| Doepelheuer, A. (1997) Emissionsmodellierung. Project Report, DLR-Interner Bericht. Abschlußbericht F & E-Vorhaben Nr. 105 06 085, Auftrag Nr. 934/375050. 74 S. Volltext nicht online. |
| Doepelheuer, A. and Kruse, H. (1997) Measurements of Trace Species in the Exhaust of Aero Engines (AEROTRACE). DLR-Interner Bericht. Finale Report 1997, Task 6, Abschlussbericht, CEC Contract No. AEREA-CT-94-0003. Volltext nicht online. |
| Dresbach, Christian and Buske, Clemens and Schmidt, Thomas and Zur, Sascha (2017) Titanium Aluminide Turbine Toolbox : Teilprojekt DLR : Schlussbericht zum Verbundprojekt TATT. Project Report. IB-334-03/17. Deutsches Zentrum für Luft- und Raumfahrt e. V.. 69 S. doi: 10.2314/GBV:101235153X. Volltext nicht frei. |
| Dreßen, S. and Zachcial, A. (2004) Analyse des Einflusses der Kavitätenströmung auf die Hauptströmung in mehrstufigen Verdichtern mittels numerischer Simulation. DLR-Interner Bericht. 325-13-04. Diploma. 72 S. Volltext nicht online. |
| Duikeren, B. van (2004) Design of heat transfer instrumentation to be applied at the wind tunnel for rotating cascades at DLR, Göttingen. Other. 225-2004 A 01. Diploma. Uni Twente, NL. 98 S. Volltext nicht online. |
| Dzikus, Niclas and Wollenheit, Richard and Schaefer, Martin and Gollnick, Volker (2014) Assessing the Potential Benefit of Future Technologies to Reduce the Environmental Impact of Airport Operations. In: AIAA AVIATION 2014 - AIAA/3AF Aircraft Noise and Emissions Reduction Symposium 2014. AIAA/3AF Aircraft Noise and Emissions Reduction Symposium, 2014-07-16 - 2014-07-20, Atlanta, USA. doi: 10.2514/6.2014-2873. Volltext nicht frei. |
| Döpelheuer, A. (2001) Characterization of Aircraft-Generated Soot by Computational Means. ASE-E31 Committee, Derby, UK, June 26-28. Volltext nicht online. |
| Döpelheuer, A. (2000) Aircraft Emission Parameter Modelling - Dossier "Aviation and the Environment". Air and Space Europe, Editions Elsevier (May-June 2000). Volltext nicht online. |
| Döpelheuer, A. (2001) Quantities, Characteristics and Reduction Potentials of Aircraft Engine Emissions. Aerospace Congress, Washington, USA, Sept. 10-14, 2001. Volltext nicht online. |
| Döpelheuer, A. and Aigner, M. and Wahl, C. (2000) Emissionen von Flugtriebwerken unter realen Betriebsbedingungen. Kolloquium der Arbeitsgruppe Luftreinhaltung der Universität Stuttgart, 5.10.2000. Volltext nicht online. |
| Döpelheuer, A. and Tilstom, J.R. (2001) New Cycle and Emission Studies - the CYPRESS Project. Air and Space Europe, Vol. 3 (No. 3/4). Volltext nicht online. |
| Döpelheuer, A. and Wahl, C. (2000) Determination of Quantities and Properties of Aircraft Engine Generated Soot. In: Aviation, Aerosols, Contrails and Cirrus Clouds Air Pollution Research Report 74, EUR 19428. Volltext nicht online. |
| Dörr, Th. and Rachwitz, L. and Schilling, Th. and Hassa, C. and Behrendt, Th. and Stursberg, K. and Heinze, J. and Jarius, M. (2002) Brennstoffaufbereitung in mager vorgemischten Flammen. 8. Statusseminar AG-TURBO: Verbundprojekt für ein CO2-armes Kraftwerk, Köln, 5./6. Dez, 2002., 2002-12-05 - 2002-12-06, Köln. Volltext nicht online. |
| Döpelheuer, Andreas and Lecht, M. (1999) Influence of engine performance on emission characteristics. In: Canada Communication Group. Inc.. pp. 20-1. ISBN 92-837-0009-0. Volltext nicht online. |
| Ebel, Paul-Benjamin and Belz, Joachim and Bunde, Manfred and Enders, Gerd and Forsthofer, Nicolai and Haubrich, Jan and Hemmert-Pottmann, Stefan and Lier, Jens-Christian and Reiber, Christoph and Zenkner, Sebastian (2020) Lessons Learned aus dem Projekt Multidisziplinäres Kompressor Konzept (MuKoKo). DLR-Interner Bericht. DLR-IB-BT-ST-2020-184. DLR Institut für Bauweisen und Strukturtechnologie. 14 S. (Unpublished) Volltext nicht online. |
| Ebel, Paul-Benjamin and Belz, Joachim and Bunde, Manfred and Enders, Gerd and Forsthofer, Nicolai and Haubrich, Jan and Hemmert-Pottmann, Stefan and Reiber, Christoph and Zenkner, Sebastian (2020) Abschlussbericht: Multidisziplinäres Kompressor Konzept (MuKoKo). DLR-Interner Bericht. DLR-IB-BT-ST-2020-168. DLR Institut für Bauweisen und Strukturtechnologie. 29 S. (Unpublished) Volltext nicht online. |
| Ebel, Paul-Benjamin and Belz, Joachim and Enders, Gerd and Forsthofer, Nicolai and Hemmert-Pottmann, Stefan and Reiber, Christoph (2020) Spezifikation Niederdruckverdichter. DLR-Interner Bericht. DLR-IB-BT-ST-2020-206. DLR Institut für Bauweisen und Strukturtechnologie. 43 S. (Unpublished) Volltext nicht online. |
| Eberz, T. (1993) Kritische Ueberpruefung und Entwicklung des numerischen Stroemungsloesers NEWT im Hinblick auf Turbomaschinenanwendungen. Other. Dipl.-Arbeit, GS Siegen, Dezember 1993. 146 S. Volltext nicht online. |
| Eckardt, D. and Krain, H. (1995) Synergie von Messung und Rechnung an Radialverdichtern. In: Beiträge zu Fluidenergiemaschinen Band 2. Verlag W. H. Faragallah, Sulzbach im Taunus. pp. 40-52. ISBN 3-929682-68-7. Volltext nicht online. |
| Egmann, S. and Reinmoller, U. and Niehuis, R. and Förster, W. and Beversdorff, M. and Gier, J. (2002) Improving 3D flow characteristics in a multistage LP turbine by means of endwall contouring and airfoil design modification - Part 1: Desing and experimental investigation. Proc. of IGTI'02, ASME TURBO EXPO 2002, Amsterdam (NL), 3-6 June, 2002.. Volltext nicht online. |
| Eickhoff, H. (2002) On steady and unsteady turbulent flame propagation. Project Report, DLR-Interner Bericht. 325-02-02. 17 S. Volltext nicht online. |
| Eickhoff, H. (2003) Turbulente Flammengeschwindigkeit. Project Report, DLR-Interner Bericht. 12-03. 16 S. Volltext nicht online. |
| Eickhoff, H. (2002) Analysis of turbulent burning velocity. Combustion and Flame, 128, pp. 347-350. Volltext nicht online. |
| Eickhoff, H. (1994) Fundamental Research on Lean Premixed Prevaporized Combustion. Minutes at the Midterm Review Meeting at the BRITE/EURAM Low Emission Combustion Program, 22.09.94, Cranfield University, England. Volltext nicht online. |
| Eickhoff, H. and Lenze, B. and Streb, H. (1993) Influence of Re-number on the spreading of H2-diffusion flames. In: Proc. Joint Meeting of the British and German Sections of the Combustion Institute, Cambridge, 29 March-2 April, 1993 1. Joint Meeting of the British and German Sections of the Combustion Institute, Queen's College, Cambridge, UK, 29.3.-2.4.1993. Volltext nicht online. |
| Eickhoff, H. and Lenze, B. and Streb, H. (1993) Influence of Reynolds-number on the spreading of H2-diffusion flames. DLR-Interner Bericht. 325-05-93. 10 S. Volltext nicht online. |
| Eickhoff, H. and Miebach, R. (Deutz Motor Köln) (1996) Full Flow particulate filtering with thermal regeneration in the exhaust of Diesel engines. International Symposium Towards Clean Diesel Engines, Nijmegen, 1996. Volltext nicht online. |
| Eickhoff, H. and Schmitz, G. and Schuetz, H. and Rachner, M. (1997) Untersuchungen zur Spray-Verdampfung und Verbrennung im Rahmen des CRAY-TECFLAM Projektes. Externes 13. Tecflam-Seminar, Koeln, Nov. 1997. Volltext nicht online. |
| Eickhoff, H. and Winterfeld, G. and Depooter, K. (1990) Fuel Injectors. In: Chapter 3 in "Design of Modern Turbine Combustors". Academic Press, London.. pp. 229-323. Volltext nicht online. |
| Eickhoff, H.E. and Braun-Unkhoff, M. and Frank, P. (2002) Lean Blowout for Swirl Stabilized Combustion. Project Report, DLR-Interner Bericht. 235-01-2002. 8 S. Volltext nicht online. |
| Eisenberg, B. (1) and Steinert, W. (1990) Entwurf und experimentelle Untersuchung eines hochbelasteten Unterschallgitters aus einem Industrieverdichter. Seminarvortrag im Institut fuer Antriebstechnik, 22. Mai 1990. Volltext nicht online. |
| Eisenlohr, G. and Dalbert, P. and Krain, H. and Pröll, H. and Richter, F. A. and Rohne, K. H. (1998) Analysis of the Transonic Flow at the Inlet of a High Pressure Ratio Centrifugal Impeller. In: ASME-Paper, 11Seiten-. IGTI, 5775-B Glenridge Dr. #370, Atlanta, GA 30328, USA. ASME-Conference, Stockholm, June 1998. Volltext nicht online. |
| Eisenlohr, G. and Krain, H. and Richter, F. A. and Tiede, V. (2002) Investigations of the Flow through a High Pressure Ratio Centrifugal Impeller. ASME Paper, GT-2002-30394 (CD: Proceedings Turbo Expo 2002), pp. 1-9. Volltext nicht online. |
| Elfert, M. (1994) The Effect of Rotation and Buoyancy on Radially Inward and Outward Directed Flow in a Rotating Circular Coolant Channel. Proceedings of 49th ATI Congress of Thermotechnical Association, Italy, Sept. 26-30, 1994. Volltext nicht online. |
| Elfert, M. (1994) The Effect of Rotation and Buoyancy on Flow Development in a Rotating Circular Coolant Channel with Radial Inward Flow. Journal of Experimental Thermal and Fluid Science, Verlag: Elsevier, New York, USA, 10Seiten-. Volltext nicht online. |
| Elfert, M. (2001) The Influence of Cooling Air Ejection on Flow Development and Heat Transfer in a Rotating Leading Edge Coolant Duct of a Film-Cooled Turbine Blade. In: Part B - Heat Transfer and Cooling in Propulsion and Power Systems, pp. 1-12. Nato, RTO (Research and Technology Organization, Paris, Frankreich. AVT Spring Meeting and Panel Business Week, Part B - Heat Transfer and Cooling in Propulsion and Power Systems Symposium on Advanced Flow Management, May 7-11, 2001, Loen, Norway. Volltext nicht online. |
| Elfert, M. (1991) The effect of rotation on local coolant side flow and heat transfer in turbine blades. 10th International Symposium on Air Breathing Engines (ISABE), Nottingham (UK), 01.-06.09.91. Volltext nicht online. |
| Elfert, M. (1993) Stroemung und Waermeuebergang in rotierenden Kuehlkanaelen. Kolloquium Energietechnik, RUB Bochum. Volltext nicht online. |
| Elfert, M. (1993) Waermeuebergang in rotierenden Kuehlkanaelen von Gasturbinenschaufeln. DLR-Interner Bericht. 325-01-93. 68 S. Volltext nicht online. |
| Elfert, M. (1994) Stroemungs- u. Waermeuebergang in rotierenden Kuehlkanaelen mit Kuehlluftausblasung. 1.Arbeitskreissitzung, AG Turbo, Turbotherm II, 28.10.1993, MTU, Muenchen. Volltext nicht online. |
| Elfert, M. (1996) Stroemung und Waermeuebergang in rotierenden Kuehlkanaelen mit Filmkuehlausblasung. Arbeitskreissitzung AG-Turbo, Turbotherm II, 21.6.96, Muenchen. Volltext nicht online. |
| Elfert, M. (1996) Stroemung und Waermeuebergang in rotierenden Kuehlkanaelen mit Filmkuehlausblasung. Arbeitskreissitzung AG-Turbo, TurbothermII, 13.12.96, Karlsruhe. Volltext nicht online. |
| Elfert, M. (1997) Stroemung und Waermeuebergang in rotierenden Kuehlluftkanaelen unter dem Einfluss von Kuehlluftausblasung. Project Report, DLR-Interner Bericht. Abschlußbericht AG Turbo, Turbotherm II, Vorhaben 2.1.8.1A. Volltext nicht online. |
| Elfert, M. and Hoevel, H. and Towfighi, K. (1996) The Influence of Rotation and Buoyancy on Radially Inward and OutwardDirected Flow in a Rotating Circular Coolant Channel. AIAA, Reston, VA (USA). Proc. of the 20th Congress of the Int. Council of the Aeronautical Sciences (ICAS), 8-13 Sept. 1996, Sorrento, Italy ICAS-Paper 96-6.10$. Volltext nicht online. |
| Elfert, M. and Jarius, M. P. (2002) Steady Fluid Flow Investigation Using L2F and PIV in a Multi-Pass Coolant System. In: Tansport Phenomena and Dynamics of Rotating Machinery, pp. 1-10. Proceedings of the 9th International Symposium on Transport Phenomena and Dynamics of Rotating Machinery, ISROMAC-9, Honolulu, Hawaii, USA, February 10-14 2002,. Volltext nicht online. |
| Elfert, M. and Jarius, M.P. (2002) Steady Fluid Flow Investigation Using L2F and PIV in a Multi-Pass Coolant System. In: Transport Phenomena and Dynamics of Rotating Machinery, ISROMAC 9, pp. 1-10. Pacific Center of Thermal-Fluids Engineering, USA. Proceedings of the 9th International Symposium on Transport Phenomena and Dynamics of Rotating Machinery, ISROMAC-9, Honolulu, Hawaii, USA, February 10-14, 2002. Volltext nicht online. |
| Elfert, M. and Jarius, M.P. (2004) Detaild flow investigation using PIV in a typical turbine cooling geometry with ribbed walls,GT-2004-53566. In: Proceeding. ASME TURBO EXPO 2004,June 14-17,2004 Vienna,Austria. Volltext nicht online. |
| Elfert, M. and Towfighi, K. (1996) Stroemung und Waermeuebergang in rotierenden Kuehlluftkanaelen unter dem Einfluss von Kuehlluftausblasung. Tagungsband zum 5. Statusseminar der Arbeitsgemeinschaft Hochtemperatur-Gasturbine, 5.-6. Maerz 1996, Sekretariat der AG-Turbo. Volltext nicht online. |
| Elfert, M. and Towfighi, K. (1997) Ermittlung des inneren Wärmeübergangs in rotierenden Kühlluftkanälen mit Filmkühlausblasung. Project Report, DLR-Interner Bericht. Abschlußbericht AG Turbo, Turbotherm II, Vorhaben 2.1.8.1B. Volltext nicht online. |
| Elfert, M. (1992) Waermeuebergang in rotierenden Kuehlkanaelen von Gasturbinenschaufeln. In: Tagungsband des 3. Statusseminars der Arbeitsgemeinschaft Hochtemperatur-Gasturbine, 3.-4.12.1992, Sekr. AG Turbo, DLR-KP, pp. 43-57. 3. Statusseminar AG TURBO, 1992-12-03 - 1992-12-04, Köln-Porz. Volltext nicht online. |
| Elfert, Martin (1993) The Effect of Rotation and Buoyancy on Flow Development in a Rotating Circular Coolant Channel. Proceedings ot the 2nd International Symposium on Engineering Turbule nce Modelling and Measurements, May 31 - June 2, 1993, Florenc, Italy. Volltext nicht online. |
| Elfert, Martin and Voges, Melanie and Klinner, Joachim (2008) Detailed Flow Investigation Using PIV in a Rotating Square-Sectioned Two-Pass Cooling System with Ribbed Walls. In: ASME-Paper, GT2008-51183. ASME Turbo Expo 2008, 2008-06-09 - 2008-06-13, Berlin, Germany. Volltext nicht frei. |
| Elfert, Martin and Schroll, Michael and Förster, Wolfgang (2010) PIV-Measurement of Secondary Flow in a Rotating Two-Pass Cooling System With An Improved Sequencer Technique. In: Proceedings of the ASME TURBO EXPO 2010, June 14-18, 2010, Glasgow, UK (GT-201). ASME TURBO EXPO 2010, 2010-06-14 - 2010-06-18, Glasgow, UK. doi: 10.1115/gt2010-23510. Volltext nicht frei. |
| Elfert, M, (1993) Wärmeübergang in rotierenden Kühlkanälen von Gasturbinenschaufeln. Project Report, DLR-Interner Bericht. Abschlußbericht AG Turbo Vorhaben 2.1.4.2. Volltext nicht online. |
| Elfert, M., Hoevel, H., Jarius, M., (2004) Optimierung von rotierenden Multipass-Kühlsystemen, Teil A: Strömungs- und Druckverlustmessung im rotierenden Modell. Project Report, DLR-Interner Bericht. Abschlussbericht AG Turbo II, Verbundvorhaben GuD-Kraftwerk, 500MW auf einer Welle, Vorhaben 2.4.4A. 107 S. Volltext nicht online. |
| Engel, K. (1990) Aufbau eines interaktiven Gitterauslegungssystems und dessen Implementierung auf einem Parallelrechner. DLR-Interner Bericht. 325-02-90. 95 S. Volltext nicht online. |
| Engel, K. (1994) Numerical Investigation of the Rotor-Stator Interaction in a Transonic Compressor Stage. Vortrag am 05.07.94, NASA-Lewis, Cleveland (OAI). Volltext nicht online. |
| Engel, K. (1995) Numerische Untersuchung des "Clocking" Effekts in einer Stator-Rotor-Stator Konfiguration. MTU Workshop, 22.09.1995, MTU Muenchen. Volltext nicht online. |
| Engel, K. (1997) Numerische Simulation der instationären Strömung in Turbomaschinenkomponenten. DLR-Forschungsbericht. 97-19. Dissertation. 135 S. Volltext nicht online. |
| Engel, K. and Eulitz, F. (1995) Entwicklung eines 3-D Navier Stokes Loesers zur Simulation der instationaeren Stroemung in Turbomaschinen. DFG-Symposium "Stroemungssimulation auf Hochleistungsrechnern", 04.05.1995, Bonn, Bad Godesberg. Volltext nicht online. |
| Engel, K. and Eulitz, F. (1996) Numerical Investigation of the Unsteady Flow Through Turbomachinery Components. CFD-Symposium, 14th Japanes CFD Conference, NAL, Chofu, Tokyo, 1996. Volltext nicht online. |
| Engel, K. and Eulitz, F. (1996) Numerische Simulation der zeitabhaengigen Stroemung in Turbomaschinenkomponenten. Zentrumskolloquium in Goettingen, 01.02.96. Volltext nicht online. |
| Engel, K. and Eulitz, F. (1996) Numerical Investigation of the Unsteady Flow through Turbomachinery Components. Vortrag bei IHI, Tokyo, 15.06.1996. Volltext nicht online. |
| Engel, K. and Eulitz, F. (1996) Numerical Investigation of the Unsteady Flow through Turbomachinery Components. Proceedings zum 14th Japanes CFD Conference NAL, Chofu, Japan Juni 1996. Volltext nicht online. |
| Engel, K. and Eulitz, F. (1997) Numerische Untersuchung der zeitabhaengigen Stroemung in Turbomaschinen-Komponenten. Vortrag ABB Baden, 27.02.1997, Baden, Schweiz. Volltext nicht online. |
| Engel, K. and Eulitz, F. (1996) Der Entwicklungsstand des 3D-Navier-Stokes Verfahrens TRACE. Workshop bei MTU Muenchen, 8.10.1996. Volltext nicht online. |
| Engel, K. and Eulitz, F. and Faden, M. and Pokorny, S. (1993) Numerical Investigation of the Unsteady Flow in Transonic Fan. Vortrag DFG-Symposium, CFD on Parallel Systems, 9.-10.12.1993, Universitaet Stuttgart. Volltext nicht online. |
| Engel, K. and Eulitz, F. and Faden, M. and Pokorny, S. (1994) Numerical Investigation of the Rotor-Stator Interaction in a Transonic Compressor Stage. 30th AIAA/ASME/SAE/ASEE Joint Propulsion Conference, June 27-29, 1994, Indianapolis. Volltext nicht online. |
| Engel, K. and Eulitz, F. and Faden, M. and Pokorny, S. (1994) Numerical Simulation of the Unsteady Turbomachinery Flow on a MIMD Machine. Vortrag auf der HPCN 1994 Conference, Muenchen, 19.04.94. Volltext nicht online. |
| Engel, K. and Eulitz, F. and Faden, M. and Pokorny, S. (1994) Validation of TVP-Schemes for Unsteady Turbomachinery Flow. In: Lecture Notes in Physics, Springer Verlag. Volltext nicht online. |
| Engel, K. and Eulitz, F. and Faden, M. and Pokorny, S. (1994) Numerical Investigation of the Shock Induced Interaction in a Transonic Compressor Stage. International Symposium on Unsteady Flows in Aeropropulsion: Recent Advances in Experimental and Computational Methods. Volltext nicht online. |
| Engel, K. and Eulitz, F. and Faden, M. and Pokorny, S. (1994) Entwicklung eines 3D Stroemungsloesers auf einem Parallelprozessorsystem zur Berechnung der instationaeren Stroemung in einer Turbomaschine (We 1450/1-3). Vortrag im Rahmen des DFG-Schwerpunktprogramms "Stroemungssimulation auf Hochleistungsrechnern", 23.-24. Juni 1994, Bad Godesberg. Volltext nicht online. |
| Engel, K. and Eulitz, F. and Gebing, H. (1996) Numerische Simulation der instationaeren Stroemung in Turbomaschinenkomponenten. Teil 1: Allgemein. Zentrumskolloquium, DLR-Göttingen, 1. Februar 1996. Volltext nicht online. |
| Engel, K. and Eulitz, F. and Gebing, H. and Faden, M. and Pokorny, S. (1996) Anwendung neuer Konzepte zur Lösung komplexer Strömungsprozesse. DLR-Nachrichten (83), pp. 6-10. Volltext nicht online. |
| Engel, K. and Eulitz, F. and Pokorny, S. (1994) Numerical Investigation of the Rotor-Stator Interaction in a Transonic Compressor Stage. 30th AIAA/ASME/SAE/ASEE Joint Propulsion Conference, June 27-29, 1994, Indianapolis, USA. Volltext nicht online. |
| Engel, K. and Eulitz, F. and Pokorny, S. (1) and Faden, M. (1) (1996) 3-D-Navier-Stokes Solver for the Simulation of the Unsteady Turbomachinery Flow on a Massively Parallel Hardware Architecture. In: Notes on Numerical Fluid Dynamics, Vol. 52: Flow Simulation with High-Performance Computers II (1996); ed. E. H. Hirschel, pp. 117-133. Volltext nicht online. |
| Engel, K. and Faden, M. and Pokorny, S. (1991) Arbeitsbericht zum Forschungsvorhaben Entwicklung eines 3-D-Strömungslösers. DFG-Schwerpunktskolloquium, 1991, Aachen. Volltext nicht online. |
| Engel, K. and Faden, M. and Pokorny, S. (1991) Arbeitsbericht zum Forschungsvorhaben 3D-instationärer Strömungslöser. DFG-Zwischenbericht 1991. Volltext nicht online. |
| Engel, K. and Faden, M. and Pokorny, S. (1991) Anfangs- und Randwertformulierung bei der Lösung der zeitabhängigen Eulergleichungen. Vortrag bei der Universität Bonn, 26.11.91. Volltext nicht online. |
| Engel, K. and Faden, M. and Pokorny, S. (1993) Implementation of Non-Reflecting Boundary Conditions in an Unsteady Flow Simulation System. In: Numerical Methods for Fluid Dynamics 4 4. pp. 483-501. Volltext nicht online. |
| Engel, K. and Faden, M. and Pokorny, S. (1993) Entwicklung eines dreidimensionalen Stroemungsloesers auf einem Parallelprozessorsystem zur Berechnung der instationaeren Stroemung in einer Turbomaschine. Vortrag im Rahmen des DFG-Schwerpunktprogramms "Stroemungssimulation auf Hochleistungsrechnern", 06.05.1993, Bad Godesberg. Volltext nicht online. |
| Engel, K. and Faden, M. and Pokorny, S. (1993) Forschungsvorhaben 3D-instationäre Strömung. Project Report. We 1450/1-1. DLR. 10 S. Volltext nicht online. |
| Engel, K. and Faden, M. and Pokorny, S. (1992) Implementation of non-reflecting boundary conditionsin an unsteady flow siulations system. ICFD conference on numerical methods for fluid dynamics, 1992-04-07 - 1992-04-10. Volltext nicht online. |
| Engel, K. and Faden, M. and Pokorny, S. (1992) Randbedingungsforulierung fuer instationaere Innenstroemungsprobleme. Kolloquium Stroemungsmaschinen Universitaet Essen, 1992-06-29, Essen. Volltext nicht online. |
| Engel, K. and Faden, M. and Pokorny, S. (1992) Numerical investigation of the unsteady flow through counterrotating fan. 18th ICAS Congress, 1992-09-20 - 1992-09-25, Peking, China. Volltext nicht online. |
| Engel, K. and Faden, M. and Pokorny, S. (1992) Entwicklung eines 3-D Stroemungsloesers. DFG-Schwerpunktskolloquium 1992, Bad Godesberg. Volltext nicht online. |
| Engel, K. and Faden, M. and Pokorny, S. (1992) Implementation of non-reflecting boundary conditions in an unsteady flow simulation system. ICFD Conference on Numerical Methods for Fluid Dynamics , 1992-04-07 - 1992-04-10. Volltext nicht online. |
| Enghardt, L. and Neise, W. and Schewe, G. and Schimming, P. and Schmitt, S. and Schnell, R. and Wallscheid, L. and Zhang, Y. (2000) Strömungsuntersuchungen in einem fünfstufigen Axialverdichter (Abschlussbericht). Project Report, DLR-Interner Bericht. --Teilprojekt 1.141, Turbotech II, FKZ: 0327040B. 88 S. Volltext nicht online. |
| Enghardt, L. and Tapken, U. and Neise, W. and Schimming, P. and Maier, R. and Zillmann, J. (2003) Active control fan noise from high-byass ratio aeroengines: experimental results. The Aeronautical Journal, 106 (1063), pp. 501-506. Volltext nicht online. |
| Euler, H.-G. (1) and Steinert, W. (1990) Experimentelle Untersuchung des Gitters TSG 89-5 im transsonischen Gitterwindkanal und Vergleich mit den Ergebnissen des Verdichtergitters LO30-4. DLR-Interner Bericht. 325-06-90. 66 S. Volltext nicht online. |
| Eulitz, F. (1998) Numerische Simulation und Modellierung der instationären Strömung in Turbomaschinen. Kolloquium an der Ruhr-Universität Bochum, 6. Mai 1998. Volltext nicht online. |
| Eulitz, F. (1998) Numerical Simulation of Unsteady Turbomachinery Flow. eingeladener Seminarvortrag Pratt & Whitney, East Hartford, CT, USA, 17.7.98. Volltext nicht online. |
| Eulitz, F. (2000) Numerische Simulation und Modellierung der instationären Strömung in Turbomaschinen. DLR-Forschungsbericht. 2000-05. Dissertation. 197 S. Volltext nicht online. |
| Eulitz, F. (1995) Vorstellung des Navier-Stokes Solver TRACE, Teil 2: Turbulenz-Modellierung. Numerische Untersuchung des Clocking-Effekts in einer Turbine, MTU-Workshop, 22.09.95, MTU Muenchen. Volltext nicht online. |
| Eulitz, F. (1996) Verfahrensentwicklung fuer die Berechnung von instationaeren Stroemungen in Turbomaschinen. BMW Rolls-Royce/DLR-Workshop: Rechenverfahren für Antriebe, DLR Köln-Porz, 18.03.1996. Volltext nicht online. |
| Eulitz, F. (1995) Unsteady Codes & Turbulence Modelling. Workshop ONERA/DLR, ONERA-Cert, Toulouse, Frankreich, 13.-14.11.1995. Volltext nicht online. |
| Eulitz, F. (1995) Numerical Simulation of Unsteady Turbomachinery Flow - Validation and Application. Workshop anlaesslich Beuch von Prof. F. Breugelmans & Mitarbeiter von VKI Bruessel, Belgien, 18.12.95, DLR Koeln-Porz. Volltext nicht online. |
| Eulitz, F. (1996) Numerische Simulation der instationaeren Stroemung in Turbomaschinen. Seminarvortrag an der TH Darmstadt, 27.8.96. Volltext nicht online. |
| Eulitz, F. and Engel, K. (1998) Numerical Investigation of Wake Interaction in a Low Pressure Turbine. 43. ASME Gas Turbine & Aeroengine Technical Congress, Stockholm, Schweden, 2.6.-6.6.98. Volltext nicht online. |
| Eulitz, F. and Engel, K. (1996) Numerische Untersuchungen der Clocking-Effekte am Beispiel einer dreistufigen Niederdruckturbine. Workshop bei MTU Muenchen, 08.10.1996. Volltext nicht online. |
| Eulitz, F. and Engel, K. (1997) Numerische Untersuchungen zum Einfluss der zeitabhaengigen reibungsbehafteten 2D-Gitterstroemung auf die zeitlichen Mittelwerte in Verdichterstufen. In: Proc. 1. Engine-3E-Workshop, MTU München, 1997. 1. Engine-3E-Workshop, MTU München, 1997. Volltext nicht online. |
| Eulitz, F. and Engel, K. (1997) Numerical Investigation of Wake Interaction in a Low Pressure Turbine. In: Proc. 33rd AIAA Joint Prop. 1997. 33rd AIAA Joint Prop., 6.-9.7.97, Seattle, WA, USA, 1997. Volltext nicht online. |
| Eulitz, F. and Engel, K. (1997) Computation of the Unsteady and Laminar-turbulent Flow in a Low Pressure Turbine. In: Proc. 11th Symp. on Turbulent Shear Flows 1997. 11th Symposium on Turbulent Shear Flows, Grenoble, Frankreich, 8.-11. Sept. 1997. Volltext nicht online. |
| Eulitz, F. and Engel, K. and Faden, M. and Pokorny, S. (1994) Validation of TVD-Schemes for Unsteady Turbomachinery Flow. Vortrag auf der 14th International Conference on Numerical Methods in Fluid Dynamics, 11-15 July, 1994, Bangalore, India. Volltext nicht online. |
| Eulitz, F. and Engel, K. and Faden, M. and Pokorny, S. (1994) Unsteady Shock-Shear Layer Interaction in a Transonic Compressor Stage. ECCOMAS 94 Conference, 5-8 Sept., Stuttgart. Volltext nicht online. |
| Eulitz, F. and Engel, K. and Faden, M. and Pokorny, S. (1994) Simulation der instationaeren Wechselwirkung in einer transsonischen Verdichterstufe. Vortrag auf NEC-DLR Kolloquium "High Performance Computing", 7-8 Nov. 1994. Volltext nicht online. |
| Eulitz, F. and Engel, K. and Gebing, H. (1995) Instationäre Strömungsvorgänge an der Stabilitaetsgrenze des Verdichters-Ansätze zu einer numerischen Untersuchung. MTU-Workshop: "Instationäre Strömungsvorgänge an der Stabilitätsgrenze des Verdichters", MTU München, 20.03.1995. Volltext nicht online. |
| Eulitz, F. and Engel, K. and Gebing, H. (1995) Instationaere Validierung eines Eingleichungs-Turbulenzmodells am Fall der selbsterregten Stossoszillation um ein Kreisbogenprofil im ebenen Kanal. In: Prpc. 7. STAB-Workshop. 7. STAB-Workshop, 14.-16. Nov. 1995, DLR Göttingen. Volltext nicht online. |
| Eulitz, F. and Engel, K. and Gebing, H. (1996) Numerische Simulation der instationaeren Stroemung in Turbomaschinenkomponenten. Teil 2: Behandlung der Turbulenz. Zentrumskolloquium, DLR-Göttingen, 1. Februar 1996. Volltext nicht online. |
| Eulitz, F. and Engel, K. and Gebing, H. (1996) Application of a one-equation eddy-viscosity model to unsteady turbomachinery flow. In: Engineering Turbulence Modelling and Experiments 3 (1996) Eds.: W. Rodi, C. Bergeles, pp. 741-751. Engineering Turbulence Modelling and Experiments 3, Editors: W. Rodi, G.Bergeles, Elsevier 1996, Proc. Heraklion+Gete,Greece,27.-29.Mai 96. Volltext nicht online. |
| Eulitz, F. and Engel, K. and Gebing, H. (1996) TRACE - Das instationaere Verfahren fuer Turbomaschinenstroemungen. Statusseminar zur MTU/DLR Kooperation "Gemeinsam zur neuen Triebwerkstechnik", 25.-26.Maerz 1996. Volltext nicht online. |
| Eulitz, F. and Engel, K. and Gebing, H. (1996) Numerische Simulation der instationaeren Stroemung in Turbomaschinen. In: DGLR-Jahresbericht 1996, Band 2. Vortrag: DGLR-Jahrestagung in Dresden, 26.09.1996 Proceed: DGLR-Jahresbericht. Volltext nicht online. |
| Eulitz, F. and Engel, K. and Gebing, H. (1996) Numerische Simulation des instationaeren Waermeuebergangs an einem Turbinenrotor unter Einschluss von Heissstellen. Vortrag auf 13. AK-Sitzung AG-Turbotech, Koeln-Porz, 18.10.96. Volltext nicht online. |
| Eulitz, F. and Engel, K. and Gebing, H. and Lisiewicz, S. (1996) Numerical Investigation of the Clocking Effects in a Multistage Turbine. In: ASME Turbo-Expo, Birmingham 1996. ASME Turbo-Expo, Birmingham, UK, 10-13 june, 1996 ASME-paper: 96-GT-26. Volltext nicht online. |
| Eulitz, F. and Engel, K. and Gebing, H. and Pokorny, S. (1995) Numerical Investigation of Invisored and Viscous Interaction in a Transonic Compressor. Vortrag zum Symposium:AGARD-PEP 85th Meeting on Loss Mechanisms and Unsteady Flows in Turbomachines, Derby, U.K. 8-12 May, 1995. Volltext nicht online. |
| Eulitz, F. and Engel, K. and Pokorny, S. (1) and Gebing, H. and Weyer, H. and Faden, M. (1) (1996) Entwicklung eines 3D-Stroemungsloesers auf einem Parallelprozessorsystem zur Berechnung der instationaeren Stroemung in einer Turbomaschinenstufe. DFG-Abschlußkolloquium, Bonn, 22. April 1996. Volltext nicht online. |
| Eulitz, F,, and Engel, K. and Nürnberger, D. and Schmitt, S. and Yamamoto, K. (1998) On Recent Advances of a Time-Accurate Parallel Navier-Stokes Solver for Unsteady Turbomachinery Flow. Computational Fluid Dynamics 1998, Proceedings of the 4th European Computational Fluid Dynamics Conference, Athens, Greece, 8 Sept. 1998. Volltext nicht online. |
| Ewert, Roland and Hartmann, R. and Held, J. and Leicht, T. and Bauer, M. and Ashcroft, G. and Weckmüller, C. and Guerin, S. and Schady, A. and Heimann, D. and Siefert, M. and Heintze, O. and Unruh, O. and Mühlbauer, Bernd and Noll, Berthold (2010) Advanced Numerical Tools Graduation for Aeronautical Research and Development. Project Report. 160 S. Volltext nicht online. |
| Eyers, C.J. and Norman, P. and Middel, J. and Plohr, M. and Michot, S. and Atkinson, K. and Christou, R.A. (2004) AERO2K Global Aviation Emissions Inventories for 2002 and 2025. Project Report. 04/01113. QinetiQ. 144 S. Volltext nicht online. |
| Faden, M. and Engel, K. and Pokorny, S. (1991) Parallele Implementierung eines integrierten Strömungssimulationssystems. GMB-Bonn, Forum "KEply" Konzepte und Einsatz paralleler Systeme 1991, 10.04.91. Volltext nicht online. |
| Faden, M. and Engel, K. and Pokorny, S. (1991) Ein interaktives Simulationssystem für instationäre Strömungen auf Transputersystemen. Vortrag Universität Bonn, 26.11.91. Volltext nicht online. |
| Faden, M. and Engel, K. and Pokorny, S. (1993) Unsteady Flow Simulation on a Parallel Computer. AIAA Computational Fluid Mechanics Conference, Orlando, Fl, 1993, USA. Volltext nicht online. |
| Faden, M. and Pokorny, S. and Engel, K. (1991) An integrated flow simulation system on a parallel computer part II, The Flow Solver. 7th International Conference on Numerical Methods in Laminar and Turbulent Flow. Volltext nicht online. |
| Faden, M. and Pokorny, S. and Engel, K. (1991) Parallele Implementierung eines integrierten Strömungssimulationssystems. GAMM-Seminar "Numerische Algorithmen auf Transputersystemen", Heidelberg, Juni 1991. Volltext nicht online. |
| Faden, M. and Pokorny, S. and Engel, K. (1991) Implementierung eines interaktiven Strömungssimulationssystems, Teil 2. GAMM Seminar "Numerische Algorithmen auf Transputersystemen", Juni 1991, Heidelberg. Volltext nicht online. |
| Faden, M. and Pokorny, S. and Engel, K. (1991) An Integrated Flow Simulation System on a Parallel Computer, Part II: The Flow Solver. 7th International Conference on Numerical Methods in Lamiunar and Turbulent Flow. Volltext nicht online. |
| Faden, M. and Pokorny, S. and Engel, K. (1991) Integriertes Strömungssimulationssystem auf einem Prallelrechner, Teil 2: Der Strömungslöser. Seminarvortrag IWR Heidelberg. Volltext nicht online. |
| Faden, M. and Pokorny, S. and Engel, K. (1992) A CFD Application on Transputer Systems. GAMM Seminar, Heidelberg. Volltext nicht online. |
| Faden, M. and Schimming, P. (1991) Strömungsanalysewerkzeuge in der Turbomaschinenforschung und Berechnung der instationären Strömung auf Parallelrechnern. Seminarvortrag in München bei der MTU, 16.10.91. Volltext nicht online. |
| Faden, M. and Engel, K. and Pokorny, S. (1992) TVD-Verfahren fuer instationaere Stroemungssimulation auf Transputern. Kolloquium Stroemungsmaschinen Universität Essen, 1992-06-29, Essen. Volltext nicht online. |
| Faden, M. and Engel, K. and Pokorny, S. (1992) Instationaere Stroemungssimulation in Triebwerkskomponenten auf massiv parallelem Rechnersystem. Seminarvortrag GMB-Bonn, Bonn. Volltext nicht online. |
| Faden, M. and Engel, K. and Pokorny, S. (1992) Numerische Simulation von Triebwerksstroemungen auf parallenen Rechnersystemen. COMETT Seminar, Industrielle Anwendung paralleler Computersysteme, Graz, Österreich. Volltext nicht online. |
| Faden, M. and Pokorny, S. and Engel, K. (1992) Numerische Simulation von Triebwerksstroemungen auf parallelen Rechnersystemen. COMETT Seminar, Industrielle Anwendung paralleler Computersysteme, Graz, Oesterreich. Volltext nicht online. |
| Faden, M. and Pokorny, S. and Engel, K. (1992) Instationaere Triebwerksstroemungen. Seminarvortrag, Universitaet Dortmund, Dortmund. Volltext nicht online. |
| Fehse, K.-R. (1997) Experimentelle Untersuchungen zur Entstehung tieffrequenter Druckschwankungen bei Radialventilatoren. Dissertation. Volltext nicht online. |
| Fehse, K.-R. and Neise, W. (1995) Entstehungsursachen tieffrequenter Druckschwankungen bei Radialventilatoren II. DLR-Interner Bericht. 92517-95/B6. 161 S. Volltext nicht online. |
| Fiala, R. and Dussa, K. (1990) Ueber Schaeume zur Loeschung von Fluessigkeitsbraenden. DLR-Interner Bericht. 325-04/90. Volltext nicht online. |
| Fischer, Andre and Bake, Friedrich and Heinze, Johannes and Diers, Olaf and Willert, Christian and Röhle, Ingo (2008) Off-line phase-averaged particle image velocimetry and OH chemiluminescence measurements using acoustic time series. Measurement Science and Technology, 20 (7). IOP. doi: 10.1088/0957-0233/20/7/075403. Volltext nicht online. |
| Fischer, M. (1992) Eine Einschaetzung des Status der Temperatur-Messgenauigkeit mit Laser-Induzierter Fluoreszenz (LIF) und der Einsatzmoeglichkeit von LIF am Brennkammer-Duesen-Pruefstand der DLR-KP. DLR-Interner Bericht. 325-01-92. Volltext nicht online. |
| Fischer, M. (1992) Eine Einschaetzung des Status der Temperatur-Messgenauigkeit mit Laserinduzierter Fluoreszenz (LIF) und der Einsatzmoeglich- keit von LIF am Brennkammer-Duesenpruefstand der DLR-KP. DLR-Interner Bericht. 325-01-92. SM-AT. Volltext nicht online. |
| Fischer, M. (1993) Temperature measurements in H2 flames. In: Vortrag bei dem DLR/ONERA Kooperationstreffen "Optical Diagnostics for HERMES TESTING Facilities", DLR Goettingen, 8.02.1993. Volltext nicht online. |
| Fischer, M. (1993) CARS-Temperaturmessungen in H2-Flammen. Vortrag auf dem LIFG-Treffen, DLR Koeln, 17.-18.5.93. Volltext nicht online. |
| Fischer, M. (1993) N2 and H2O CARS thermometry for RAM and SCRAM jet combustion chambers. DLR-Onera Kooperationstreffen, LAERTE/ONERA-Palaiseau, 7.12.1993. Volltext nicht online. |
| Fischer, M. (1994) N2- und H2O-CARS-Einzelpulsmessungen in planarer BOX-CARS-Konfiguration an der mit H2 und Luft betriebenen Brennkammer des BDP-A. Abschlusstreffen zur Messkampagne am BDP-A, Institut fuer Antriebstechnik, DLR-Koeln, 23.-24. Febr. 1994. Volltext nicht online. |
| Fischer, M. (1994) N2-CARS im Graphitofen. LIF 7 Meeting, DLR-Stuttgart, 17.-18.10.1994. Volltext nicht online. |
| Fischer, M. (1994) CARS on N2 and H2O-selected results 1994. DLR/ONERA Kooperationstreffen, DLR-Lampoldshausen, 14.-15.11.1994. Volltext nicht online. |
| Fischer, M. (1995) Cars at the DLR-Cologne - New Results 1995. DLR/ONERA Kooperationstreffen, ONERA-Palaiseau, 19.-20. Juni 1995,. Volltext nicht online. |
| Fischer, M. (1996) CARS activities at the DLR-Cologne. DLR/ONERA Kooperationstreffen, DLR-Goettingen, 25.-25.6.1996. Volltext nicht online. |
| Fischer, M. (1996) Zur N2-CARS-Thermometrie in H2-Luft Flammen bei Druecken bis 10 bar. LIF-Treffen, DLR Koeln, 18.-19. Juni 1996. Volltext nicht online. |
| Fischer, M. and Heinze, J. and Matthias, K. and Röhle, I. (2000) Doppler Global Velocimetry in flames using a newly developed, frequency stabilized, tunable, Long pulse, Nd: YAG Laser. 10th International Symposium on Applications of Laser Techniques to Fluid Mechanics, Session 35, Lisbon, Portugal, July 10-13, 2000. Volltext nicht online. |
| Fischer, M. and Heinze, J. and Matthias, K. and Röhle, I. (2001) Doppler Global Velocimetry in an atmospheric kerosene spray combustor using a newly developed, frequency stabilized, tunable, long pulse ND:YAG laser. 20th European CARS Workshop, Institute of Technology, University Lund, Schweden, April 1-3, 2001. Volltext nicht online. |
| Fischer, M. and Magens, E. and Schodl, R. and Stursberg, K. and Winandy, A. (1990) Projected Car Measurements on a Ram-Jet Nozzle at the DLR Cologne. Ninth European Cars Workshop, 19-20 March 1990, Dijon, France.. Volltext nicht online. |
| Fischer, M. and Magens, E. and Schodl, R. and Stursberg, K. and Winandy, A. (1991) CARS status at the DLR Cologne. In: Proc. Techn. European CAS Workshop 1991. Technical European CAS Workshop, MPI, Institut für Quantenoptik, Garching, 18.-19.03.1991. Volltext nicht online. |
| Fischer, M. and Magens, E. and Weisgerber, H. and Winandy, A. and Cordes, S. (1998) CARS temperature measurements on an air breathing ramjet model. 36th Aerospace Sciences Meeting and Exhibit, Reno, NV, January 12-15, 1998. Volltext nicht online. |
| Fischer, M. and Magens, E. and Weisgerber, H. and Winandy, A. and Cordes, S. (1999) Coherent Anti-Stokes Raman Scattering Temperature Measurements on an Air Breathing Ramjet Model. AIAA Journal, 37 (6), pp. 744-750. Volltext nicht online. |
| Fischer, M. and Magens, E. and Winandy, A. (1992) Single-shot broadband nitrogen CARS measurement with temperatures up to 2900 K; Comparison of different data evaluation schemes. Posterpraesentation auf dem XI' th European CARS Workshop Florenz, 23.-25.k03.92. Volltext nicht online. |
| Fischer, M. and Magens, E. and Winandy, A. (1994) N2- und H2O-CARS-Einzelpulsmessungen in planarer BOX-CARS-Konfiguration an der mit H2 und Luft betriebenen Brennkammer des BDP-A. DLR-Interner Bericht. 325-12-94. 20 S. Volltext nicht online. |
| Fischer, M. and Magens, E. and Winandy.A., (1994) N2- und H2O-Cars-Einzelpulsmessungen in planarer BOX-CARS-Konfiguration an der mit H2 u. Luft begtriebenen Brennkammer des BDP-A. DLR-Interner Bericht. 325-08-94. 17 S. Volltext nicht online. |
| Fischer, M. and Stockhausen, G. and Heinze, J. and Seifert, M. and Mueller, M. and Schodl, R. (2004) Development of Doppler Global Velocimetry(DGV)measurement devices and combined application of DGV and OH*-chemiluminescence imaging to gas turbine combustor. In: Proceedings. <12th Intern.Symp.on Applications of Laser Techniques to Fluid Mechanics,12-15 July,2004,Lisbon,Portugal. Volltext nicht online. |
| Fischer, M. (1992) CARS-Aktivitaeten bei der DLR-Koeln. LIF 5 Meeting, 1992-09-27 - 1992-09-28, Lampoldshausen. Volltext nicht online. |
| Fischer, M. (1992) First N2-measurements up to approximately 3100 K at the DLR- Cologne. Meeting HERMES diagnostic group, , 1992-02-24, Köln-Porz. Volltext nicht online. |
| Fischer, M. and Magens, E. and Winandy, A. (1992) Single-shot broadband nitrogen CARS measurements with temperature up to 3200K: Comparison of different data evaluation shemes. In: World Scientific Publishing Co Pte Ltd, Singapore. XI`th European CARS Workshop, 1992-03-23 - 1992-03-25, Florence, Italy. Volltext nicht online. |
| Fischer, Michael (2006) Untersuchungen zur Einsatzfähigkeit der N<sub>2</sub> - und H<sub>2</sub>O-CARS-Thermometrie und H<sub>2</sub>O-CARS-Konzentrationsmessung bei der Analyse von H<sub>2</sub>-Staustrahltriebwerken. Dissertation, Technische Universität Berlin. Volltext nicht online. |
| Fischer, Michael and Heinze, Johannes and Müller, Martin and Diers, Olaf and Schneider, Denis (2007) Optical Diagnostics on a Catalytic Burner. In: 2007 DLR-ONERA MOTAR Meeting. Selbstverlag ONERA-Meudon. MOTAR Meeting 2007, 2007-04-03 - 2007-04-04, Paris Meudon (Frankreich). Volltext nicht online. |
| Fischer, Michael and Magens, Eggert and Weisgerber, Hedwig and Winandy, Adi and Cordes, Sebastian (1999) Coherent Anti-Stokes Raman Scattering Temperature Measurements on an Air Breathing Ramjet Model. AIAA Journal, 37 (6), pp. 744-750. AIAA. Volltext nicht online. |
| Fischer, Michael and Magens, Eggert and Winandy, Adi (1995) N<sub>2</sub> and H<sub>2</sub>O thermometry at high pressure and temperature. XIV´th European CARS Workshop, 1995-03-29 - 1995-03-31, El Escorial, Spanien. Volltext nicht online. |
| Fischer, Michael and Magens, Eggert and Winandy, Adi (1994) Nitrogen and water CARS measurements in planar BOX-CARS configuration at the exit of a ram jet combustion chamber. XIII'th European CARS Workshop, 1994-03-21 - 1994-03-22, Gif sur Yvette, La Terrasse (France). Volltext nicht online. |
| Fischer, Michael and Heinze, Johannes and Müller, Martin and Diers, Olaf and Schneider, Dennis (2008) Optical diagnostics on a catalytic burner. ECONOS 2008 / microCARS 2008, 2008-05-25 - 2008-05-27, Igls (Austria). Volltext nicht frei. |
| Fischer, Michael and Magens, Eggert and Koch, Uwe and Esser, Burkard and Gülhan, Ali (2016) Development and application of an improved CARS set-up for the characterization of high enthalpy flow fields. DIVA12 – Diagnostik in Verbrennung und Aerodynamik, 2016-10-12 - 2016-10-13, Berlin –Charlottenburg. (Unpublished) Volltext nicht online. |
| Fleing, Ch. (1998) Phänomenstudium an der mageren Verlöschgrenze von drallstabilisierten Kerosin-Flammen. DLR-Interner Bericht. Diploma. Volltext nicht online. |
| Foerster, W. (1994) Laser Two Focus Velocimetry Applied to TsAGI's Supersonic Combustor Test Rig T 131. 3rd Working Group meeting "Scramjet Technology". Volltext nicht online. |
| Foerster, W. (1995) Laser Two Focus Velocimetry Applied to TsAGI's Supersonic Combustor Test Rig T 131. TsAGI International Workshop on Scramjet Technology, Zhukovsky, Russia. Volltext nicht online. |
| Foerster, W. and Schodl, R. (1991) Neue Entwicklungen beim Laser-2-Fokus-Verfahren in Turbomaschinen. In: Jahrbuch 1991 der DGLR. DGLR-Jahrestag 1991, 10.-13.09.91 in Berlin. Volltext nicht online. |
| Foerster, W. and Schodl, R. (1994) Auswahl und Anwendung laseroptischer Messverfahren an SCRAMJET-Brennkammern bei TsAGI (GUS). DLR-Interner Bericht. 325-04-94. 7 S. Volltext nicht online. |
| Foerster, W. and Schodl, R. (1996) SCRAMJET-Technologie. Messtechnik, Auswahl und Anwendung laseroptischer Messverfahren an SCRAMJET-Brennkammern bei TsAGI (GUS). DLR-Interner Bericht. 325-02-96. 272 S. Volltext nicht online. |
| Fradin, C. and LeGuevel, A. and Guernigon, J. and Billonnet, C. and Röhle, I. (1999) Application de la tomoscopie laser à la localisation des configurations des ondes de choc dans le coupes des canaux interaubes des compresseurs axiaux transsoniques. Project Report, DLR-Interner Bericht. 38 S. Volltext nicht online. |
| Frank, P. and Tan, Y. and Griebel, P. and Nannen, H. and Eickhoff, H. (1996) Analysis of NO-Formation for Rich/Lean-Staged Combustion. In: 3rd Workshop on Modelling Chem. Systems. 3rd Workshop on Modelling Chem. Systems, Heidelberg, 1996. Volltext nicht online. |
| Freitag, Stefan and Ulrich, Meier and Johannes, Heinze and Thomas, Behrendt and Christoph, Hassa (2010) Measurement of Initial Conditions of a Kerosene Spray from a Generic Aeroengine Injector at Elevated Pressure. ILASS – Europe 2010 23rd Annual Conference on Liquid Atomization and Spray Systems, 2010-09-06 - 2010-09-08, Tschechische Republik, Brünn. ISBN 978-80-7399-997-1. Volltext nicht online. |
| Frenk, A. (1991) Triebwerksmodellierung für ein Staustrahltriebwerk mit Überschallverbrennung im Machzahlbereich 5 bis 15. DLR-Interner Bericht. 325-13-91. 128 S. Volltext nicht online. |
| Freund, Oliver and Rehder, Hans-Juergen and Schäfer, Philipp and Röhle, Ingo (2011) Experimental Investigations on Cooling Air Ejection at a Straight Turbine Cascade Using PIV and QLS. ASME Turbo Expo 2011, 2011-06-06 - 2011-06-10, Vancouver, Kanada. Volltext nicht online. |
| Frey, Christian and Kersken, Hans-Peter and Voigt, Christian and Ashcroft, Graham (2012) Time-Linearized and Time-Accurate 3D RANS Methods for Aeroelastic Analysis in Turbomachinery. Journal of Turbomachinery, 134 (5). American Society of Mechanical Engineers (ASME). doi: 10.1115/1.4004749. ISSN 0889-504X. Volltext nicht online. |
| Frey, Christian (2014) Physical Interpretation of Discrete and Continuous Adjoint Boundary Conditions. Dagstuhl Seminar 14371: Adjoint Methods in Compuational Science, Engineering and Finance, 2014-09-07 - 2014-09-12, Leibniz Zentrum für Informatik, Schloss Dagstuhl, Deutschland. (Unpublished) Volltext nicht online. |
| Frey, Christian and Ashcroft, Graham and Kersken, Hans-Peter and Voigt, Christian (2014) A Harmonic Balance Technique for Multistage Turbomachinery Applications. ASME Turbo Expo 2014, 2014-06-16 - 2014-06-20, Düsseldorf, Deutschland. doi: 10.1115/GT2014-25230. Volltext nicht online. |
| Frey, Christian and Ashcroft, Graham and Kersken, Hans-Peter and Voigt, Christian (2015) Simulations of Unsteady Blade Row Interactions using Linear and Non-linear Frequency Domain Methods. In: JOURNAL OF ENGINEERING FOR GAS TURBINES AND POWER-TRANSACTIONS OF THE ASME. ASME Turbo Expo 2015: Turbine Technical Conference and Exposition, 2015-06-15 - 2015-06-19, Montreal, Kanada. doi: 10.1115/GT2015-43453. Volltext nicht online. |
| Frey, Christian and Ashcroft, Graham and Kersken, Hans-Peter and Weckmüller, Christian (2012) Advanced Numerical Methods for the Prediction of Tonal Noise in Turbomachinery, Part II: Time-Linearized Methods. ASME TurboExpo 2012, 2012-06-11 - 2012-06-15, Kopenhagen, Dänemark. doi: 10.1115/GT2012-69418. Volltext nicht online. |
| Frey, Christian and Kersken, Hans-Peter (2014) A hybrid mesh linear harmonic solver for the aeroelastic analysis of turbomachinery. In: Joint 11th World Congress on Computational Mechanics, WCCM 2014, the 5th European Conference on Computational Mechanics, ECCM 2014 and the 6th European Conference on Computational Fluid Dynamics, ECFD 2014. 6th. European Conference on Computational Fluid Dynamics - ECFD VI, 2014-07-20 - 2014-07-25, Barcelona, Spanien. |
| Frey, Christian and Schlüß, Daniel and Wolfrum, Nina and Bechlars, Patrick and Beck, Maximilian (2020) On the Formulation of Nonreflecting Boundary Conditions for Turbomachinery Configurations. Part I: Theory and Implementation. In: ASME Turbo Expo 2020: Turbomachinery Technical Conference and Exposition, GT 2020, 2C, V02CT35A037. ASME Turbo Expo 2020 Turbomachinery Technical Conference & Exposition, 2020-09-21 - 2020-09-25, Virtual, Online. doi: 10.1115/GT2020-15358. ISBN 978-079188419-5. Volltext nicht online. |
| Fröhler, Benjamin and Pohya, Ahmad Ali and Häßy, Jannik and Kilian, Thomas and Bismark, Alexander Heinz and Radestock, Martin and Cruz, David (2024) Performance and Economic Assessment of a Wing-Integrated Hybrid Laminar Flow Control System. In: 34th Congress of the International Council of the Aeronautical Sciences, ICAS 2024. 34th Congress of the International Council of the Aeronautical Sciences, ICAS 2024, 2024-09-09 - 2024-09-13, Florenz, Italy. ISSN 2958-4647. |
| Fröhler, Benjamin and Pohya, Ahmad Ali and Häßy, Jannik and Kilian, Thomas and Bismark, Alexander Heinz and Radestock, Martin and Cruz Palacios, David (2025) Performance and economic assessment of a wing-integrated hybrid laminar flow control system. The Aeronautical Journal, pp. 1-28. Cambridge University Press. doi: 10.1017/aer.2025.26. ISSN 0001-9240. |
| Fuchs, R. (1990) Design and Experimental Investigation of a Supercritical Compressor Rotor Blade Section. Institute of Thermophysics Academia Sinica, 10 October 1990, Bei, PR China; Gas Turbine Establishment, 17 October 1990, Jiangyou, PR China. Volltext nicht online. |
| Fuchs, R. (1991) Transonic Compressor Cascade Flow with Shock Induced Boundary Layer Separation. Euromech 274, Prag, 08.-11.04.91 Videofilm!. Volltext nicht online. |
| Fuchs, R. and SChreiber, H.A. (1995) Entwicklung einer Enturfsmethode fuer transsonische Axialverdichtergitter. Project Report, DLR-Interner Bericht. 7 S. Volltext nicht online. |
| Fuchs, R. and Schreiber, H. A. (1995) Entwicklung einer Entwurfsmethode für transsonische Axialverdichtergitter. Project Report, DLR-Interner Bericht. Zwischenbericht II/94 AG-Turbo 1995. 6 S. Volltext nicht online. |
| Fuchs, R. and Schreiber, H. A. and Steinert, W. and Küsters, B. (1998) Ein verlustminimiertes Verdichtergitter für einen transsonischen Rotor - Entwurf und Analyse. VDI Düsseldorf. VDI-GET Tagung, Hannover, 6.-7. Okt. 1998. Volltext nicht online. |
| Fuchs, R. and Schreiber, H.A. (1993) Entwicklung einer Entwurfsmethode fuer transsonische Axialverdichtergitter, Zwischenbericht 1/93 zum AG-Turbo/TURBOTECH Vorhaben "Hochtemperatur-Gasturbine". Project Report, DLR-Interner Bericht. 6 S. Volltext nicht online. |
| Fuchs, R. and Schreiber, H.A. (1994) Entwicklung einer Entwurfsmethode fuer transsonische Axialverdichtergitter. Project Report, DLR-Interner Bericht. Halbjahresbericht 1/94, AG-Turbo. 7 S. Volltext nicht online. |
| Fuchs, R. and Schreiber, H.A. (1995) Entwicklung einer Entwurfsmethode fuer transsonische Axialverdichtergitter. Vortrag 11. AK-Sitzung TURBOTECH, 16.10.1995, Koeln-Porz, DLR. Volltext nicht online. |
| Fuchs, R. and Schreiber, H.A. (1996) Entwicklung einer Entwurfsmethode fuer transsonische Axialverdichtergitter. Project Report, DLR-Interner Bericht. 139 S. Volltext nicht online. |
| Fuchs, R. and Schreiber, H.A. and Starken, H. (1993) Entwicklung einer Entwurfsmethode fuer transsonische Axialverdichter-gitter. Postervortrag auf der Arbeitskreissitzung AG-Turbo-TURBOTECH Koeln 14.-15.10.1993. Volltext nicht online. |
| Fuchs, R. and Schreiber, H.A. and Starken, H. (1993) Entwicklung einer Entwurfsmethode für transsonische Axialverdichtergitter. Other. AG Turbo. 6 S. Volltext nicht online. |
| Fuchs, R. and Schreiber, H.A. and Steinert, W. (1996) Auslegung und experimentelle Untersuchung des transsonischen Rotorgitters TAGT 1.2. DLR-Interner Bericht. 325-08-96. 136 S. Volltext nicht online. |
| Fuchs, R. and Schreiber, H.A. and Steinert, W. (1996) Auslegung und experimentelle Untersuchung des transsonischen Rotorgitters DLR-TAGT 1.2. DLR-Interner Bericht. bitte Löschen-doppelt. Volltext nicht online. |
| Fuchs, R. and Schreiber, H.A. and Weber, A. and Steinert, W. (1998) Räumliche Strömungen in transsonischen Verdichtergittern. Turbotech Arbeitskreissitzung, Köln, 15.-16.10.1998. Volltext nicht online. |
| Fuchs, R. and Steinert, W. and Starken, H. (1993) Transonic Compressor Rotor Cascade with Boundary-Layer Separation: Experimental and Theoretical Results. The American Society of Mechanical Engineers, NEW York, USA. International Gas Turbine and Aeroengine Congress and Exposition Cincinnaiti,Ohio, May 24-27, 1993, ASME Paper 93-GT-405. Volltext nicht online. |
| Fuchs, R. and Weber, T. (1997) Raeumliche Stoemungen in transsonischen Verdichtergittern sehr hoher Belastung. 15. AK-Sitzung TURBOTECH, 23.10.1997, DLR Koeln-Porz. Volltext nicht online. |
| Fuchs, S. (1991) Strömung durch ein transsonisches Verdichtergitter mit stoßinduzierter Grenzschichtablösung. Institutsseminar, Köln, 14.05.91 Videofilm!. Volltext nicht online. |
| Förster, W. (1995) Laser-2-Focus Data Analysis Using a Non Linear Regression Model. 16th International Congress on Instrumentation in Aerospace Simulation Facilities, July 18-21, 1995, Dayton, Ohio, USA. Volltext nicht online. |
| Förster, W. and Beversdorff, M. and Karpinski, G. and Schodl, R. (2001) 3D-Laser Messungen im mehrstufigen Niederdruck-Turbinenrigg und Analyse. Abschlussbericht 1996-2000 AG-TURBO, Turbotech II, Teilprojekt 1,423, Fachkennzeichen:0327040B. Project Report, DLR-Interner Bericht. 325-05-01. Volltext nicht online. |
| Förster, W. and Beversdorff, M. and Seifert, M. (2003) Lasermessungen am LARGE SCALE TURBINE RIG bei der ILA in Stuttgart. Project Report, DLR-Interner Bericht. DLR-IB-325-14-03. 57 S. Volltext nicht online. |
| Förster, W. and Karpinski, G. and Beversdorff, M. and Röhle, I. and Schodl, R. (2000) 3-Komponenten Strömungsuntersuchungen mittels der Doppler-Laser-2-Fokus Technik in einem transsonischen Radialverdichter. In: Lasermethoden in der Strömungsmesstechnik, 8. Fachtagung, GALA, 13.1-13.6. Shaker Verlag. Lasermethoden in der Strömungsmesstechnik, 8. Fachtagung, Freising/Weihenstephan, 12.-14.September 2000. ISBN 3826578090. Volltext nicht online. |
| Förster, W. and Karpinski, G. and Beversdorff, M. and Röhle, I. and Schodl, R. (2000) 3D-Lasermessungen im mehrstufigen Niederdruckturbinenrig und Analyse. AG Turbo, 21. AK-Sitzung, Köln, 12.-13. Oktober 2000. Volltext nicht online. |
| Förster, W. and Schodl, R. (1995) Auswahl und Anwendung laseroptischer Meßverfahren an SCRAMJET-Brennkammern bei TsAGI (GUS). DLR-Interner Bericht. 325-02-95. 13 S. Volltext nicht online. |
| Förster, W. and Schodl, R. and Beversdorff, M. and Klemmer, A. and Rijmenants, E. (1990) Design and Experimental Verification of 3-D Velocimeters Based on the Laser-2-Focus Technique. In: Proc. of the 5th Int. Symp. on Application of Laser Technique to Fluid Mechanics, 9-12 July 1990 (1990). Volltext nicht online. |
| Führer, Tanja and Görtz, Stefan and Abu-Zurayk, Mohammad and Ilic, Caslav and Keye, Stefan and Banavara, Nagaraj and Kruse, Martin and Brodersen, Olaf and Liepelt, René and Becker, Richard-Gregor and Bach, Tobias and Jepsen, Jonas and Ciampa, Pier Davide and Kohlgrüber, D. and Scherer, Julian and Kier, Thiemo and Leitner, Martin and Siggel, Martin (2014) Entwicklung einer Softwareplattform für die Multidisziplinäre Optimierung eines Gesamtflugzeugs. Deutscher Luft- und Raumfahrtkongress 2014, 2014-09-16 - 2014-09-18, Augsburg, Deutschland. Volltext nicht frei. |
| Gallrein, V. (1996) Bildkalibrierung zur Erzeugung von Doppler-Global-Velocimeter Geschwindigkeitsbildern. DLR-Interner Bericht. 325-11-96. 103 S. Volltext nicht online. |
| Gante, Laura (2019) Numerische Simulation der Strömung in der Messkammer eines Sondenkalibrierkanals. Bachelor's, Hochschule Emden/Leer. Volltext nicht frei. |
| Gante, Laura (2022) CFD-Simulation von Drallerzeuger und Heizer im Windkanal für ebene Gitter (EGG). Master's, Technische Universität Braunschweig. Volltext nicht online. |
| Gante, Laura and Bachner, Johannes Ricco and Brakmann, Robin (2019) Numerische Simulation der Strömung in der Messkammer eines Sondenkalibrierkanals. DLR-Interner Bericht. DLR-IB-AT-GO-2019-113. Bachelor's. Hochschule Emden-Leer. Volltext nicht online. |
| Gardner, R.M. and Adams, J.K. and Cook, T. and Larson, L.G. and Falk, R.S. and Fleuti, E. and Förtsch, W. and Lecht, M. and Lee, D.S. and Leech, M.V. and Lister, D.H. and Massé, B. and Morris, K. and Newton, P.J. and Owen, A. and Parker, E. and Schmitt, A. and ten Have, H. and Vandenberghe, C. (1998) UNSPECIFIED In: Aircraft Emissions - Inventories for 1991/92 and 2015 Report produced by ECAC/ANCAT and EC Working Group. ISBN 92-828-2914-6. Volltext nicht online. |
| Gawehn, Thomas and Schodl, Richard (2007) A planar Mie scattering visualization technique for turbo machinery application. Measurement Science and Technology, 18 (12), pp. 3688-3696. Institute of Physics (IOP) Publishing. doi: 10.1088/0957-0233/18/12/003. ISSN 0957-0233. Volltext nicht frei. |
| Gebing, H. (1995) Analyse instationärer Strömungsfelder. München, 22.09.1995. Volltext nicht online. |
| Gebing, H. and Engel, K. and Eulitz, F. (1996) Numerical Analysis of the Unsteady Flow Fields in a Multistage Turbine. In: Proc. 15th Int. Conference on Numerical Methods in Fluid Dynamics 1996. 15th International Conference on Numerical Methods in Fluid Dynamics (ICNMDFD), June 24-28, 1996, Monterey, California. Volltext nicht online. |
| Gebing, H. and Engel, K. and Eulitz, F. (1996) Analysis of Complex Unsteady Flow Fields in Turbomachinery Aerodynamics. In: Proceedings ECCOMAS '96 (1996). ECCOMAS 96, Paris, 9-13. Sept., 1996. Volltext nicht online. |
| Gebing, H. and Eulitz, F. and Engel, K. (1996) Analyse und Komprimierung instationaerer Stroemungsfelder der numerischen und experimentellen Simulation. 10. DGLR-Fach-Symposium "Stroemungen mit Abloesung", 11-13. Nov. 1996 Braunschweig. Volltext nicht online. |
| Geihe, Benedict and Matha, Marcel and Schuff, Matthias (2020) Modellierung von Sekundärströmung in Axial-Verdichtern mit hoher Schaufelbelastung unter Berücksichtigung des Off-Design- Verhaltens. DLR-Interner Bericht. DLR-IB-AT-KP-2020-138. Deutsches Zentrum für Luft- und Raumfahrt. 201 S. |
| Geiser, Georg and Wellner, Jens and Kügeler, Edmund and Weber, Anton and Moors, Anselm (2018) On the Simulation of unsteady Turbulence and Transition Effects in a Multistage Low Pressure Turbine, Part II: Full-Wheel Simulation. In: Proceedings of the ASME Turbo Expo. ASME 2018 Turbo Expo, 2018-06-11 - 2018-06-15, Oslo, Norwegen. doi: 10.1115/GT2018-76764. Volltext nicht online. |
| Geisler, Reinhard and Schröder, Andreas and Willert, Christian and Elsinga, Gerrit (2009) Investigation of vortex-generators within a turbulent boundary layer flow using time-resolved tomographic PIV. 3rd AEROCHINA2 Workshop on Multi-physics and Policy Meeting EU-China on RTD Collaboration in Aeronautics, 2009-09-23, Brüssel (Belgien). Volltext nicht online. |
| Ghanipour, A. (2004) Experimentelle Bestimmung der Grenzschichtparameter von spanabhebend gefertigten Oberflächen und numerische Modellierung. DLR-Interner Bericht, Project Report. 225-2004 A 03A. 190 S. Volltext nicht online. |
| Gierens, Klaus and Braun-Unkhoff, Marina and Le Clercq, Patrick and Plohr, Martin and Schlager, Hans and Wolters, Florian (2016) Condensation trails from biofuels/kerosene blends scoping study. [Other] |
| Gieß, P. and Kost, F. (2003) Transition and Passage Loss Determination within Three Turbine Cascades. Appendix A. DLR-Interner Bericht. 225-2002 C 02A. 138 S. Volltext nicht online. |
| Gieß, P.-A. (2001) Experimental Investigations of the Flow Field within Two Improved Turbine Cascades Designed by Honda. DLR-Interner Bericht, Project Report. 225-2001 C 04. 69 S. Volltext nicht online. |
| Gieß, P.-A. (2001) Experimental Investigations of the Flow Field within Two Improved Turbine Cascades Designed by Honda. Appendix B. DLR-Interner Bericht, Project Report. 225-2001 C 04B. 84 S. Volltext nicht online. |
| Gieß, P.-A. (2001) Experimental Investigations of the Flow Field within Two Improved Turbine Cascades Designed by Honda. Appendix A. DLR-Interner Bericht, Project Report. 225-2001 C 04A. 84 S. Volltext nicht online. |
| Gieß, P.-A. (2004) Systematische Untersuchungen an einer film-gekühlten Turbinenplattform mit anschließen-der Optimierung der Ausblasekonfiguration. 9. Statusseminar der AG TURBO, 1. - 2.12.2004, Köln. Volltext nicht online. |
| Gieß, P.-A. and Kost, F. and Dannhauer, A. (2000) Transsonische Strömung in einem Gasturbinenlaufrad - experimentelle Untersuchungen im ebenen Gitter und im rotierenden Ringgitter. Forschung im Ingenieurwesen, 66 (3), pp. 107-120. Volltext nicht online. |
| Gieß, P.-A. and Rehder, H.-J. and Kost, F. (2000) A new test facility for probe calibration offering independent variation of Mach and Reynolds number. The XVth Bi-Annual Symposium on Measuring Techniques in Transonic and Supersonic Flow in Cascades and Turbomachines, Florence, 21.-22. September 2000, Florenz. Volltext nicht online. |
| Gieß, P.-A. and Rehder, H.-J. and Willburger, A. (2003) Überprüfung der Kalibration der Keilsonde KWU1. DLR-Interner Bericht. 225-2003 C 05. 62 S. Volltext nicht online. |
| Gieß, P.-A. and Tiedemann, M. (2002) Experimental Investigation of the Flow Field within Two Turbine Cascades Designed by Alstom. DLR-Interner Bericht. 225-2002 C 03. 73 S. Volltext nicht online. |
| Giodano, D. and Willert, C. and Grammartini, S. and Gallodoro, R. (2002) PIV Post Processing Methods Applied on High Turbulent GT Burner Flames. 25th Event of the Italian Section of the Combustion Institute: "Combustion and Sustainable Development", Roma, June 3-5, 2002.. Volltext nicht online. |
| Giuliani, F. and Becker, J. and Hassa, C. (2004) Investigation of vapour phase issued from an air-blast injector with swirl cup using the VIS-IR extinction technique. DLR/ONERA AnnexII Meeting, Köln, 6-7.4.2004. Volltext nicht online. |
| Giuliani, F. and Berthoumieu, P. and Becker, J. and Hassa, C. (2004) The effect of ambient air pressure on planar liquid sheet disintegration at gas-turbine conditions. In: 19th. ilass Europe'04, 19, pp. 68-75. AlphaGraphics, Nottingham. 19. Int. Conf. on Liquid Atomization and Spray Systems, Nottingham, 6-8.9.2004. Volltext nicht online. |
| Giuliani, F. and Gajan, P. and Biscos, Y. and Diers, O. and Ledoux, M. (2001) Analyse de L'écoulement diphasique généré par un injecteur de type aérodynamique en régime pulsatoire forcé. 9ième Congrès FLUVISU, Rouen, France, June 18-21, 2001. Volltext nicht online. |
| Giuliani, F. and Gajan, P. and Diers, O. and Ledoux, M. (2002) Influence of pulsed air entries on a spray generated by an air-blast injection device : an experimental analysis on combustion instability process in aeroengines. In: Proceedings of the Combustion Institute the Combustion Institute. Volltext nicht online. |
| Giuliani, F. and Gajan, P. and Diers, o. and Ledoux, M. (2001) Analyse en moyenne de phase du champ de vitesse de l'air issue d'un injecteur aérodynamique en régime pulsatoire forcé. 15ième Congrès Francaise de Mécanique, Nancy, France, September 3-7, 2001. Volltext nicht online. |
| Giuliani F., and Diers O., and Gajan P., and Ledoux M., (2002) Characterisation of an air-blast injection device with forced periodic entries. In: IUTAM Symposium on Turbulent Mixing and Combustion Kluwer Academic Publishers. ISBN 1-4020-0747-7. Volltext nicht online. |
| Giuliani, F, and Becker, J, and Hassa, C, (2004) Investigation of vapour phase. Project Report, DLR-Interner Bericht. 325-04-04. 55 S. Volltext nicht online. |
| Giuliani, F, and Hassa, C, (2003) Status Report - Droplet Size Measurements. Project Report, DLR-Interner Bericht. 325-11-03. 69 S. Volltext nicht online. |
| Goinis, Georgios (2018) Entwicklung und Anwendung von modernen optimierungsfähigen Auslegungsverfahren unter Berücksichtigung des Realgaseinflusses : Forschungsvorhaben 03ET7040R Verbundvorhaben COOREFLEX-turbo Teilvorhaben 1.2.4d. Project Report. Deutsches Zentum für Luft- und Raumfahrt. doi: 10.2314/GBV:1031809341. |
| Goinis, Georgios and Benvenuto, Marcello and Mosele, Stefano Gino and Schneider, Andrea (2022) Simulation of a Multistage Compressor at Low Load Operation with Additional Bleed Air Extraction for Minimum Environmental Load Reduction. GPPS Chania22, 2022-09-18 - 2022-09-20, Chania, Griechenland. doi: 10.33737/gpps22-tc-96. ISSN 2504-4400. |
| Goinis, Georgios and Voß, Christian and Nicke, Eberhard (2021) The Potential of Casing Treatments for Transonic Compressors: Evaluation Based on Axial-Slot and Rotor Blade Optimization. In: 32nd Congress of the International Council of the Aeronautical Sciences, ICAS 2021. 32nd Congress of the International Council of the Aeronautical Sciences, 2021-09-06 - 2021-09-10, Shanghai, China. ISBN 978-393218291-4. |
| Grewe, Volker and Stenke, Andrea and Plohr, Martin and Korovkin, Vladimir D. (2010) Climate functions for the use in multi-disciplinary optimisation in the pre-design of supersonic business jet. The Aeronautical Journal, 114 (1154), pp. 259-269. Cambridge University Press. doi: 10.1017/s0001924000003705. ISSN 0001-9240. Volltext nicht frei. |
| Grewe, Volker and Dahlmann, Katrin and Flink, Jan and Frömming, Christine and Ghosh, Robin and Gierens, Klaus Martin and Heller, Romy and Hendricks, Johannes and Jöckel, Patrick and Kaufmann, Stefan and Kölker, Katrin and Linke, Florian and Luchkova, Tanja and Lührs, Benjamin and van Manen, Jesper and Matthes, Sigrun and Minikin, Andreas and Niklaß, Malte and Plohr, Martin and Righi, Mattia and Rosanka, Simon and Schmitt, Angela Rebecca and Schumann, Ulrich and Terekhov, Ivan and Unterstrasser, Simon and Vazquez-Navarro, Margarita and Voigt, Christiane and Wicke, Kai and Yamashita, Hiroshi and Zahn, Andreas and Ziereis, Helmut (2017) Mitigating the Climate Impact from Aviation: Achievements and Results of the DLR WeCare Project. Aerospace, 4 (3), pp. 1-50. Multidisciplinary Digital Publishing Institute (MDPI). doi: 10.3390/aerospace4030034. ISSN 2226-4310. |
| Grewe, Volker and Plohr, Martin and Cerino, G. and Di Muzio, M. and Deremaux, Yann and Galerneau, M. and de Staint Martin, P. and Chaika, T and Hasselrot, A. and Tengzelius, Ulf and Korovkin, Vladimir D. (2010) Estimates of the climate impact of future small-scale supersonic transport aircraft – results from the HISAC EU-project. The Aeronautical Journal, 114 (1153), pp. 199-206. Cambridge University Press. ISSN 0001-9240. |
| Grewe, Volker and Plohr, Martin and Cerino, Gerino and Di Muzio, Massimiliano and Deremaux, Yann and de Saint Martin, Philippe and Chaika4, Taras and Hasselrot5, Anders and Tengzelius5, Ulf and Korovkin, Vladimir (2009) Small-scale supersonic transport aircraft (S4TA): HISAC project. Transport Atmosphere and Climate TAC-2, 2009-06-22 - 2009-06-25, Aachen, Germany. |
| Griebel, P. (1994) Messtechnik fuer die experimentelle Untersuchung von schadstoffarmen Gasturbinenbrennkammern. In: Minutes des Workshops zur Schadstoffenstehung-, umwandlung- und ausbreitung von der Brennkammer bis zum Zerfall der Wirbelschuppe, Schad. stoffe in der Luftfahrt, 2/94, Stuttgart. Volltext nicht online. |
| Griebel, P. (1996) Experimentelle Untersuchung eines atmosphaerischen Fett-Mager-Brennkammersektors fuer Flugtriebwerke. Kolloquium Energietechnik, Universitaet Bochum, Institut fuer Energietechnik, 17. Jan 1996. Volltext nicht online. |
| Griebel, P. (1997) Untersuchung zur schadstoffarmen Verbrennung bei atmosphaerischem Druck in einem fett-mager-gestuften Brennkammersektor fuer Flugtriebwerke. Vortrag am Paul Scherrer Institut (PSI), Villingen, Schweiz, 1997. Volltext nicht online. |
| Griebel, P. (1997) Untersuchung zur schadstoffarmen Verbrennung bei atmosphaerischem Druck in einem fett-mager-gestuften Brennkammersektor fuer Flugtriebwerke. Vortrag bei der MTU Muenchen, 1997. Volltext nicht online. |
| Griebel, P. (1997) Untersuchung zur schadstoffarmen, atmosphaerischen Verbrennung in einem Fett-Mager-Brennkammersektor fuer Flugtriebwerke. DLR-Forschungsbericht. 97-48. Dissertation. 120 S. Volltext nicht online. |
| Griebel, P. and Behrendt, T. and Hassa, C. and Lueckerath, R. and Bergmann, V. and Stricker, W. and Zarzalis, N. (1995) Untersuchung eines atmosphärischen Fett-Mager-Brennkammersektors für Flugtriebwerke. 17. Deutscher Flammentag, 13.09.1995, Hamburg. Volltext nicht online. |
| Griebel, P. and Behrendt, T. and Hassa, C. and Lueckerath, R. and Bergmann, V. and Stricker, W. and Zarzalisn, N. (1995) Investigation of an Atmospheric Rich-Quench-Lean Combustor Sector for Aeroengines. BRITE/EURAM Low NOx II Meeting, CFD Technical Review Task 4.1, 1995-09-27, Muenchen. Volltext nicht online. |
| Griebel, P. and Bergmann, V. and Lueckerath, R. and Behrendt, T. and Hassa, C. (1995) RQL rectangular combustor CARS measurements and LDV measurements. Vortrag zum RQL Expert Group Meeting, Juni 1995, Poitiers, Frankreich. Volltext nicht online. |
| Griebel, P. and Hassa, C. (1996) Subtask 1.2.5: LDV Measurement in the Rectangular Combustor Final Report. Project Report, DLR-Interner Bericht. Abschlußbericht BRITE EURAM Low NOx II, Subtask 1.2.5, Contract No. AERR-CT92-0036. 7 S. Volltext nicht online. |
| Gross, Johann and Gupta, Vasudev and Berthold, Christian and Krack, Malte (2024) A new paradigm for multi-fidelity continuation using parallel model refinement. Computer Methods in Applied Mechanics and Engineering, 423, p. 116860. Elsevier. doi: 10.1016/j.cma.2024.116860. ISSN 0045-7825. Volltext nicht online. |
| Gugel, K.O. (1995) Experimentelle Untersuchung der Zwei-Phasen-Strömung in einem Vormischkanal. Vortrag am 16.02.1995 an der Universität Karlsruhe (TH), Engler-Bunte-Institut. Volltext nicht online. |
| Görtz, Stefan (2019) Digital Aircraft Design - DLR research and synergies with national projects. tandemAEROdays 2019, 2019-05-27 - 2019-05-29, Bukarest, Rumänien. Volltext nicht online. |
| Görtz, Stefan (2025) High-Fidelity Gradient-Based MDO Capabilities at DLR - Recent Developments. 4th European Workshop on Multidisciplinary Design Optimization (MDO) for Industrial Applications in Aeronautics, 2025-06-03 - 2025-06-05, Toulouse, France. (Unpublished) Volltext nicht online. |
| Görtz, Stefan and Abu-Zurayk, Mohammad and Ilic, Caslav and Wunderlich, Tobias and Keye, Stefan and Schulze, Matthias and Klimmek, Thomas and Kaiser, Christoph and Süelözgen, Özge and Kier, Thiemo and Schuster, Andreas and Dähne, Sascha and Petsch, Michael and Kohlgrüber, Dieter and Häßy, Jannik and Mischke, Robert and Weinert, Alexander and Knechtges, Philipp and Gottfried, Sebastian and Hartmann, Johannes and Fröhler, Benjamin (2020) Overview of Collaborative Multi-Fidelity Multidisciplinary Design Optimization Activities in the DLR Project VicToria. In: AIAA Aviation 2020 Forum. AIAA Aviation Forum 2020, 2020-06-15 - 2020-06-19, Virtual Event. doi: 10.2514/6.2020-3167. ISBN 978-162410598-2. |
| Görtz, Stefan and Abu-Zurayk, Mohammad and Ilic, Caslav and Wunderlich, Tobias and Schulze, Matthias and Kaiser, Christoph and Süelözgen, Özge and Schuster, Andreas and Dähne, Sascha and Petsch, Michael and Häßy, Jannik and Gottfried, Sebastian and Mischke, Robert and Knechtges, Philipp and Hartmann, Johannes (2019) Collaborative high fidelity and high performance computing-based MDO strategies applied to transport aircraft design. 2nd European Workshop on MDO for Industrial Applications in Aeronautics, 2019-11-19 - 2019-11-20, Toulouse, France. Volltext nicht online. |
| Görtz, Stefan and Ilic, Caslav and Abu-Zurayk, Mohammad and Wunderlich, Tobias and Schulze, Matthias and Klimmek, Thomas and Süelözgen, Özge and Kier, Thiemo and Schuster, Andreas and Petsch, Michael and Häßy, Jannik and Becker, Richard-Gregor and Siggel, Martin and Kleinert, Jan and Mischke, Robert and Gottfried, Sebastian (2021) Collaborative High Fidelity and High Performance Computing-Based MDO Strategies for Transport Aircraft Design. In: 32nd Congress of the International Council of the Aeronautical Sciences, ICAS 2021. 32nd Congress of the International Council of the Aeronautical Sciences (ICAS2021), 2021-09-06 - 2021-09-10, Shanghai, China. ISBN 978-393218291-4. Volltext nicht online. |
| Görtz, Stefan and Ilic, Caslav and Jepsen, Jonas and Leitner, Martin and Schulze, Matthias and Schuster, Andreas and Scherer, Julian and Becker, Richard-Gregor and Zur, Sascha and Petsch, Michael (2017) Multi-Level MDO of a Long-Range Transport Aircraft Using a Distributed Analysis Framework. In: AIAA-2017-4326. 18th AIAA/ISSMO Multidisciplinary Analysis and Optimization Conference, 2017-06-05 - 2017-06-09, Denver, USA. doi: 10.2514/6.2017-4326. Volltext nicht online. |
| Görtz, Stefan and Klimmek, Thomas and Zur, Sascha and Becker, Richard-Gregor and Kier, Thiemo and Kohlgrüber, Dieter and Schuster, Andreas and Jepsen, Jonas (2017) Overview and main challenges of MDO at DLR. 1st European Workshop on MDO for Industrial Applications in Aeronautics - Challenges and Expectations, 2017-10-24 - 2017-10-25, Braunschweig, Germany. Volltext nicht online. |
| Görtz, Stefan and Krumbein, Andreas and Ritter, Markus and Hofmann, Johannes (2018) DLR-Projekt VicToria - Virtual Aircraft Technology Integration Platform. Deutscher Luft- und Raumfahrtkongress 2018, 2018-09-04 - 2018-09-06, Friedrichshafen. Volltext nicht online. |
| Habing, Remco and van der Meulen, Mark-Jan and Heut, Maxime and Jaron, Robert and Petrosino, Francesco and Barbarino, Mattia and Zaporozjets, Oleksandr (2024) Dual-Stream Jet Noise Test with Internal Mixer Design Variations for LTO Noise of Supersonic Aircraft. In: 34th Congress of the International Council of the Aeronautical Sciences, ICAS 2024. ICAS 2024, 2024-09-09 - 2024-09-13, Florenz, Italien. ISSN 2958-4647. Volltext nicht online. |
| Habisreuther, P. and Eickhoff, H. and Lenze, B. (1996) Experimental and Theoretical Investigations on the Formation of Thermal NOx in Confined Premixed and Nonpremixed Swirling Flames. 26th International Symposium on Combustion, Naples, Italy, 1996. Volltext nicht online. |
| Habisreuther, P. and Eickhoff, H. and Lenze, B. (1997) Experimentelle und Numerische Untersuchungen an einer eingeschlossenen Erdgas-Drall-Diffusionsflamme. 18. Deutsch-Niederländischer-Flammentag, Delft, Sept. 1997. Volltext nicht online. |
| Hage, W. and Bechert, D. and Bruse, M. (1997) Experiments with the drag reducing slip wall. Euromech 3rd European Fluid Mechanics Conference 1997, Göttingen, September 1997. Volltext nicht online. |
| Hage, W. and Bechert, D.W. and Bruse, M. (1997) Experiments with the drag reducing slip wall. Euromech Colloquium 361, "Active Control of Turbulent Shear Flows" and Final Colloquium of DFG Research Group Control of Turbulent Flows, TU Berlin, März 1997. Volltext nicht online. |
| Hage, W. and Bechert, D.W. and Bruse, M. (1997) Drag reduction from shark skin to the technical optimum. 2nd International Conference on Flow Interaction cum Exhibtion/ Lectures on Interaction of Science & Art (SCART), Berlin, Juli 1997. Volltext nicht online. |
| Hage, W. (1) and Meyer, R. (1) and Bechert, D.W. (1997) Artificial bird feathers: An adaptive wing with high lift capability. 50th Annual Meeting, Division of Fluid Dynamics, American Physical Society, San Francisco, USA, 23.-25.11.97. Volltext nicht online. |
| Hah, C. and Krain, H. (1989) Secondary Flows and Vortex Motion in a High-Efficiency Backswept Impeller at Design and Off-Design Conditions. The American Society of Mechanical Engineers, ASME Paper (89-GT-181), pp. 1-10. Volltext nicht online. |
| Hah, C. and Krain, H. (1999) Analysis of Transonic Flow Fields inside a High Pressure Ratio Centrifugal Compressor at Design and Off Design Conditions. ASME-Paper, June 1999, Indianapolis, USA (ASME-Paper 99-GT-446), pp. 1-15. Volltext nicht online. |
| Hah, C. and Krain, H. (1990) Secondary Flows and Vortex Motion in a High-Efficiency Backswept Impeller at Design and Off-Design Conditions. In: Transactions of the ASME, Journal of Turbomachinery, Vol. 112, (1990) No. 1., Vol. 112. ASME, New York. Volltext nicht online. |
| Hampe, L. (1990) Konstruktiver Entwurf einer Brennkammer fuer einen Hyperschall-Schubduesen-Pruefstand. Diploma. Volltext nicht online. |
| Hassa, C. (2001) Triebwerksbrennkammern im Zentrum für Verbrennungsforschung des DLR in Köln. In: DGLR Nachrichten. Bezirksgruppe Köln/Bonn, DGLR, Haus der Luft- und Raumfahrt, 11.04.2001. Volltext nicht online. |
| Hassa, C. (2001) Pulsationen in Flugtriebwerken / Flüssige Brennstoffe. Fachveranstaltung Verbrennungsschwingungen H 030110891, Universität der Bundeswehr, Hamburg, 13.11.2001. Volltext nicht online. |
| Hassa, C. (1990) Untersuchung von 2-Phasen-Stroemungen mit dem PDA. Lehrgang Laser-Doppler-Anemometer, Technische Akademie Esslingen 1990. Volltext nicht online. |
| Hassa, C. (1991) Untersuchungen von 2-Phasenströmungen mit dem PDA. Lehrgang "Laser-Doppler-Anemometer" bei der Technischen Akademie Esslingen. Volltext nicht online. |
| Hassa, C. (1994) Experimentelle Untersuchung der turbulenten Partikeldispersion in Drallströmungen. DLR-Forschungsbericht. 94-20. Dissertation. 153 S. Volltext nicht online. |
| Hassa, C. (1995) Gestufte Verbrennung in Flugtriebwerken. Seminarreihe des ZARM, Fallturm Bremen, 23./24. Mai 1995. Volltext nicht online. |
| Hassa, C. (1995) Forschungs- und Technologiearbeiten im Verbrennungslabor des Instituts für Antriebstechnik. Präsentation des Instituts für Antriebstechnik bei BMW-RR Aeroengines, Dahlewitz, 29.05.1995. Volltext nicht online. |
| Hassa, C. (1995) Arbeiten zur Kraftstoffaufbereitung in Brennkammern am Institut für Antriebstechnik. Präsentation des Instituts für Antriebstechnik bei ABB, Baden, Schweiz, 24.03.1995. Volltext nicht online. |
| Hassa, C. (1995) Kraftstoff-Aufbereitung in Brennräumen. Besuch der Gruppe Turbulenz in Brennräumen, AT-TF, BL, 06.02.1995, Köln-Porz. Volltext nicht online. |
| Hassa, C. (1994) Instationary atomization and dispersion characteristics of a prefilming flatsheet airblast atomizer. DLR-Interner Bericht. 325-09-94. 36 S. Volltext nicht online. |
| Hassa, C. (1994) Experimentelle Untersuchung der turbulenten Partikeldispersion in Drallstroemungen. Vortrag an der Fakultaet fuer Maschinenbau Bochum, Institut fuer Energieanlagentechnik, 12.04.1994. Volltext nicht online. |
| Hassa, C. (1994) Characterization de l'atomization et de la dispersion instationnaire d'un atomiseur de géometrie bidimensionelle. Seminarvortrag am DERMES der CERT/ONERA, 25.02.1994, Toulouse, France. Volltext nicht online. |
| Hassa, C. (1996) Brennstoffaufbereitung und Mischung. Engine 3E Partner-Status-Workshop, 11.-12.03.1996, Berlin-Dahlewitz, Vorhaben "Technologische Grundlagen schadstoffarmer Verbrennung". Volltext nicht online. |
| Hassa, C. (1996) Aktuelle Problemstellungen schadstoffarmer Luftfahrt-Gasturbinenbrennkammern. "Clusterseminar" Antriebe und Verbrennung, 9.12.96, Lampoldshausen. Volltext nicht online. |
| Hassa, C. (1996) Experimentelle Untersuchungen in schadstoffarmen Modellbrennkammern. Vortrag an TU München 1996. Volltext nicht online. |
| Hassa, C. (1997) Tests of First Advanced Cooling Mixing Concept. BRITE/EURAM "Low Emissions Combustion Technology" Low NOx II/Experts Meeting, Lissabon, 29.01.1997. Volltext nicht online. |
| Hassa, C. (1996) Druckeinfluss auf die magere Stabilitaetsgrenze. Arbeitskreissitzung KEROMIX, Uni Karlsruhe, 21.10.1996. Volltext nicht online. |
| Hassa, C. (1996) Gemischbildung in schadstoffarmen Brennkammern. Workshop Emissionen des Luftverkehrs und ihre Wirkung auf die Atmosphäre, 13.-14. Mai 1996, DLR-FZ Adlershof. Volltext nicht online. |
| Hassa, C. and Arold, M. (1995) Investigation of Droplet Concentration Fluctuations in a Research Spray Combustion Chamber. In: Proc. 11th European Conference of ILASS Europe on Atmization and Sprays. Nürnberg 1995, 11, pp. 23-32. Nürnberg Messe GmbH, ISBN-921590-34-5. Proceedings 11th European Conference of ILASS Europe on Atomization and Sprays, Nürnberg, 21.-23.03.1995. Volltext nicht online. |
| Hassa, C. and Behrendt, T. and Frodermann, M. and Heinze, J. and Stursberg, K. (1999) Zerstäubung, Mischung und Flammen-Stabilität in hochbelasteten, schadstoffreduzierten Brennkammern für militärische Triebwerke. DLR-Interner Bericht. 325-04-99. 80 S. Volltext nicht online. |
| Hassa, C. and Behrendt, T. and Griebel, P. (1996) LDA-Messungen in einem atmosphaerischen Fett-Mager-Brennkammersektor fuer Flugtriebwerke. In: Lasermethoden in der Strömungsmeßtechnik, 5. Fachtagung, 11.-13.09.1996, Berlin. Shaker, Aachen. Lasermethoden in der Stroemungsmesstechnik, 5. Fachtagung, 11.-13.09. 1996, Berlin der Deutschen Gesellsch. f. Laser-Anemometrie. Volltext nicht online. |
| Hassa, C. and Behrendt, T. and Heinze, J. (2003) Experimentelle Untersuchung eines Vormischbrennerkonzepts für die magere Vormischverbrennung mit Vorverdampfung in Gasturbinen. In: 21. Deutscher Flammentag, 1750, pp. 289-296. VDI Verlag, Düsseldorf. 21. Deutscher Flammentag, Cottbus, 9-10. 9. 2003. ISBN 3-18-091750-4. Volltext nicht online. |
| Hassa, C. and Biscos, Y. and Lavergne, G. (1994) Instationary Atomization and Dispersion Characteristics of a prefilming flatsheet airblast atomizer. Begell House, NY, USA. Poster '95, Proceedings at the 6th. Int. Conference on Liquid Atomization and Spray Systems, New York, USA, 18.-22.07.94. Volltext nicht online. |
| Hassa, C. and Bluemcke, E. and Brandt, M. and Deick, A. and Arold, M. (1995) Untersuchungen zur turbulenten Partikeldispersion an einer Luftstrom-Zerstäuberdüse. Seminarvortrag am Hermann-Föttinger-Institut, Technische Universität Berlin, 28.04.1995. Volltext nicht online. |
| Hassa, C. and Bluemcke, E. and Brandt, M. and Eickhoff, H. (1991) Die Struktur eines Sprays in verdrallter Strömung. 7. Tecflam-Seminar, DLR-Stuttgart, 14.11.1991. Volltext nicht online. |
| Hassa, C. and Blümcke, E. and Eickhoff, H. (1990) Measurements of Eulerian Macro Timescales in Highly Swirling Flows a nd Comparison with a Computational Model. In: Proceedings.. 5th Int. Symposium on Application of Laser Techniques to Fluid Mechanics, 9-12 July 1990, Lisbon, Portugal.. Volltext nicht online. |
| Hassa, C. and Blümcke, E. and Eickhoff, H. (1990) The Application of Phase-Doppler-Anemometry to an Airblast Atomizer-Burner-Configuration. Nato Advanced Study Institute on Combusting Flow Diagnostics, Montech oro 1990. Volltext nicht online. |
| Hassa, C. and Brandt, M. (1997) Investigation of Cross-stream injection in High Pressure Duct. Minutes of Expert Meeting "Focused Generic Combustion", BRITE/EURAM Low Emission Combustion III, IST Lissabon, 30.01.1997. Volltext nicht online. |
| Hassa, C. and Graben, M. and Heinze, J. and Stursberg, K. (2001) Untersuchung der Antwort einer Luftstromzerstäuberversuchsbrennkammer-Konfiguration der Luftzufuhr bei realistischen Betriebsbedingungen. Deutscher Luft- und Raumfahrtkongress 2001, Hamburg, 17-20 Sept. 2001. Volltext nicht online. |
| Hassa, C. and Griebel, P. and Behrendt, T. (1995) LDV & Cars measurements in rectangular combustor. RQL Expert Group Meeting, Karlsruhe, 07.12.1994, Brite Euram/Low Emission Combustor Technology Program. Volltext nicht online. |
| Hassa, C. and Heinze, J. and Stursberg, K. (2001) Response of a research combustor on forced oscillations at realistic operating conditions. LECT Workshop on Instabilities, DLR Stuttgart, 4.12.2001. Volltext nicht online. |
| Hassa, C. and Heinze, J. and Stursberg, K. (2002) Investigation of the response of an air blast atomiser combustion chamber configuration on forced modulation of air feed at realistic operating conditions. Proceedings ASME TURBO EXPO 2002, The 47th ASME International Gas Turbine & Aeroengine Technical Congress, paper GT-2002-30059, Amsterdam, june 3-6, 2002.. Volltext nicht online. |
| Hassa, C. and Heinze, J. and Stursberg, K. (2003) Investigation of the Response of an Air Blast Atomizer Combustion Chamber Configuration on Forced Modulation of Air Feed at Realistic Operation Conditions. Transactions of the ASME - A - Engineering for Gas Turbines and Power, 125, pp. 862-878. Volltext nicht online. |
| Hassa, C. and Hungenberg, H.G. and Schodl, R. (1999) Das DLR-Zentrum für Verbrennungsforschung. DLR-Nachrichten (92), pp. 20-21. Volltext nicht online. |
| Hassa, C. and Migueis, C.E. and Voigt, P. (1998) Design Principals for the Quench Zone of Rich-Quench-Lean Combustors. In: Design Principles and Methods for Aircraft Gas Turbine Engines, 18-1-18-11. Canada Communication Group Inc.. RTO-Symposium, Toulouse, Frankreich, 12.05.1998. ISBN 92-837-0005-8. Volltext nicht online. |
| Hassa, C. and Rachner, M. (1996) Messung der Zweiphasenstroemung (Tropfengeschwindigkeit und -groesse)in einer Oelmischvorstrecke. Vortrag bei der TURBOFLAM Arbeitskreissitzung, TU Dresden, 18.10.96. Volltext nicht online. |
| Hassa, C. and Schodl, R. and Hungenberg, H.-G. and Becker, J. and Behrendt, Th. and Carl, M. and Heinze, J. and Stursberg, K. (2002) Experimental Investigations for the Verification of Gas Turbine Combuster CFD at the DLR Institute of Propulsion Technology. Poster Presentation at SFB 568 Workshop, Darmstadt, 14/15 Nov., 2002.. Volltext nicht online. |
| Hassa, C. and Voigt, P. and Lehmann, B. and Schodl, R: and Carl, M. and Ripplinger, T: and Zarzalis, M. (2002) Flow field mixing characteristics of an aero-engine combustor - Part 1: Experimental results. 38th IAA/ASME/SAE/ASEE Joint Propulsion Conference and Exhibit, Indianapolis (US), 7-10 July, 2002. Volltext nicht online. |
| Hassa, C. and Voigt, P. and Schodl, R. and Carl, M. and Ripplinger, T. and Zarzalis, N. and Lehmann, B. (2002) Flow-field mixing characteristics of an aero-engine combustor - Part 1: Experimental results. In: Proceedings of 38th AIAA/ASME/SAE/ASEE Joint Propulsion & Exhibit. 38th AIAA/ASME/SAE/ASEE Joint Propulsion Conference & Exhibit, 7.-10. July 2002,. Volltext nicht online. |
| Hassa, C. and Winandy, A. and Brandt, M. (1991) Messen mit dem Laser - damit Kraftstoff besser verbrennt. DLR-Nachrichten, 63, pp. 49-52. Volltext nicht online. |
| Hassa, Ch. and Hungenberg, H. G. and Schodl, R. (2002) Test rigs and instrumentation - New capabilities of DLR's combustion test center in Cologne. 4th ONERA-DLR Aerospace Symposium, Cologne (Ger) 13/14 June 2002. Volltext nicht online. |
| Hausmann, J. and Kocian, F. and Nicke, E. (2004) Realisation of a new compressor concept by usage of metal and polymer matrix compositeas for aeroengines. In: Materials & Process Technology -the Driver for Tomorrow's Improved Performance (Proceedings of the 25th International SAMPE Europe conference of the Society for the Advancement of Materials and Process Engineering, Paris 2004), 1, pp. 159-164. CLA Ltd, London. 25th International SAMPE Europe conference of the Society for the Advancement of Materials and Process Engineering, Paris EXPO, Porte de Versailles, Paris, Frankreich, 30.03-01.04.2004. ISBN 3-9522677-1-6. Volltext nicht online. |
| Heesen, W. (1) and Lindener, N. (2) and Neise, W. (1996) Elimination of a high-frequency narrow-band noise component in a low-noise automobile wind tunnel. In: Vehicle Aerodynamics: Wind tunnels, CFD, Aeroacoustics, and ground transportation systems. SP-1145 (1996) 197-206. SAE Conference, Feb. 26-29, 1996, Detroit, USA. Volltext nicht online. |
| Hein, O. (1990) Waermeuebergang, Kuehlkanal. 3. Arbeitskreissitzung AG-Turbo, 16. Maerz 1990, Muelheim an der Ruhr.. Volltext nicht online. |
| Heinrich, Jörg (2011) Strukturmechanik Gesamttool für das Projekt EVITA. DLR-Interner Bericht. [DLR-IB 435-2011/13]. DLR ST. 135 S. (Unpublished) Volltext nicht online. |
| Heinrich, Jörg and Schmidt, Thomas (2011) Strukturmechanik-Tools im Projekt EVITA: Schnelle Abschätzung strukturmechanischer Eigenschaften der Verdichter- und Turbinenbauteile Schaufelblatt, Rotordisk und Containment eines Turbo-Strahltriebwerks. DLR-Interner Bericht, Project Report. [DLR-IB 435-2011/08]. DLR e.V.. 32 S. (Unpublished) Volltext nicht online. |
| Heinze, J. and Fischer, M. and Röhle, I. and Schodl, R. (2000) DGV-Messungen in Flammen. In: Lasermethoden in der Strömungsmesstechnik. Shaker Verlag, Aachen (Deutschland), 2000. Lasermethoden in der Strömungsmesstechnik, 8. Fachtagung, GALA 2000. ISBN 3-8365-7809-0. Volltext nicht online. |
| Heinze, Johannes and Diers, Olaf and Magens, Eggert and Meier, Ulrich (2009) Phase-resolved 2D diagnostics of self-excited combustion oscillations in a gas turbine model combustor. Gordon Research Conference - Laser Diagnostics in Combustion, 2009-08-16 - 2009-08-21, Waterville Valley, NH (USA). Volltext nicht frei. |
| Helming, K. (1994) Experimental and Numerical Investigation of a Shock Wave within a Swept Shrouded Propfan Rotor. ASME. ASME Tagung, 1994. Volltext nicht online. |
| Helming, K. (1996) Numerical Analysis of Sweep Effects in Shrouded Propfan Rotors. Journal of Propulsion and Power, Vol. 12, Nr. 1, S. 139-145, Jan./Feb. 1996. American Inst. of Aeronautics and Astronautics, INC, Washington, USA. Volltext nicht online. |
| Heltsch, N. (2000) Experimentelle Untersuchung eines Fett-Mager-Brennkammersektors als Pilotstufe einer brennstoffgestuften Flugtriebwerksbrennkammer. DLR-Interner Bericht. 325-02-2000. Diploma. 84 S. Volltext nicht online. |
| Hemmer, Harry and Schaefer, Martin and Otten, Tom (2008) Einfluss lärmarmer An- und Abflugverfahren auf NO<sub>X</sub>- und CO<sub>2</sub>-Emissionen im Flughafennahbereich. In: DGLR Jahrbuch 2008. Deutscher Luft- und Raumfahrtkongress 2008, 2008-09-23 - 2008-09-25, Darmstadt. Volltext nicht online. |
| Hemmert-Pottmann, Stefan and Forsthofer, Nicolai and Voß, Christian and Schneider, Tim (2019) High-dimensional multi-fidelity optimisation of a 2.5 stage low pressure compressor. In: ISABE. ISABE 2019, 2019-09-22 - 2019-09-27, Canberra, Australien. Volltext nicht online. |
| Hendricks, J. and Kärcher, B. and Döpelheuer, A. and Feichter, J. and Lohmann, U. (2004) Potential Impact of Aviation-Induced Black Carbon on Cirrus Clouds: Global Model Studies with the ECHAM GCM. Project Report. 83. EC. 249 S. Volltext nicht online. |
| Hendricks, Johannes and Kärcher, Bernd and Döpelheuer, Andreas and Feichter, Johann and Lohmann, Ulrike (2003) Global model studies on the contribution of air traffic to the black carbon budget of the tropopause region. EGS, General Assembly, 2003-04-06 - 2003-04-11, Nice (France). Volltext nicht online. |
| Hendricks, Johannes and Kärcher, Bernd and Döpelheuer, Andreas and Feichter, Johann and Lohmann, Ulrike (2003) Global model studies on the contribution of air traffic to the black carbon budget of the tropopause region. In: Journal of Aerosol Science, pp. 1051-1052. European Aerosol Conference 2003, 2003-08-31 - 2003-09-05, Madrid, Spain. ISSN 0021-8502. Volltext nicht online. |
| Hennemann, Sebastian and Rueda-Ramírez, Andrés M. and Hindenlang, Florian J. and Gassner, Gregor J. (2020) A provably entropy stable subcell shock capturing approach for high order split form DG for the compressible Euler equations. Journal of Computational Physics. Elsevier. doi: 10.1016/j.jcp.2020.109935. ISSN 0021-9991. |
| Henning, Arne and Plohr, Martin and Özdemir, Doruk and Hepting, Michael and Keimel, Hermann and Sanok, S. and Sausen, Robert and Pregger, Thomas and Seum, Stefan and Heinrichs, Matthias and Müller, Stephan and Winkler, Christian and Neumann, Thorsten and Seebach, Oliver and Matthias, Volker and Vogel, Bernhard (2016) The DLR Transport and the Environment Project - Building competency for a sustainable mobility future. DLR-Forschungsbericht. DLR-FB-2015-38. 192 S. |
| Hensch, Ann-Katrin and Guntermann, Peter and Dues, Michael and Steinbock, Jonas and Siswanto, Adi and Stockhausen, Guido and Fischer, Michael and Burow, Eike and Beversdorff, Manfred (2023) Entwicklung eines laseroptischen Punktsensors auf Basis der Filtered Rayleigh Scattering Technik zum Einsatz unter kryogenen Bedingungen. In: 30. Fachtagung Lasermethoden in der Strömungsmesstechnik, 30. Fachtagung „Lasermethoden in der Strömungsmesstechnik“ (GALA), 2023-09-05 - 2023-09-07, München. ISBN 978-3-9816764-9-5. ISSN 2194-2447. Volltext nicht online. |
| Herbst, Florian (2024) Keynote at ISABE 2024: Towards Climate Compatible Propulsion. In: ISABE 2024. 26th Conference of the International Society for Air Breathing Engines, ISABE 2024, 2024-09-22 - 2024-09-27, Toulouse, Frankreich. Volltext nicht frei. |
| Herbst, Florian (2024) Towards Climate Compatible Propulsion. In: Energie- und Verfahrenstechnisches Kolloquium, Leibniz Universität Hannover, Hannover. Energie- und Verfahrenstechnisches Kolloquium, Leibniz Universität Hannover, 2024-11-26, Hannover, Deutschland. Volltext nicht online. |
| Herbst, Florian (2024) Perspective of the Institute of Propulsion Technology. In: Rolls-Royce Research Partners Seminar. Rolls-Royce Research Partners Seminar, 2024-09-17, Dahlewitz, Deutschland. Volltext nicht online. |
| Herbst, Florian (2024) Prospects of CFD-Methods in a Transforming Aero Engine Market. In: Frontiers in Aeronautics, Lecture Series, University of Twente. Frontiers in Aeronautics, Lecture Series, University of Twente, Netherlands, 2024-05-13, Twente, Niederlande. Volltext nicht frei. |
| Herbst, Florian (2025) Towards Climate Compatible Propulsion. Frontiers in Aeronautics, Lecture Series, University of Twente, Netherlands, 2025-04-22, Twente, Netherlands. Volltext nicht frei. |
| Hergt, Alexander and Grund, Sebastian and Klinner, Joachim and Steinert, Wolfgang and Beversdorff, Manfred and Siller, Ulrich (2019) Some Aspects of the Transonic Compressor Tandem Design. ASME Journal of Turbomachinery, 141 (9), 091003. American Society of Mechanical Engineers (ASME). doi: 10.1115/1.4043280. ISSN 0889-504X. Volltext nicht online. |
| Hergt, Alexander and Klinner, Joachim and Wellner, Jens and Willert, Christian and Grund, Sebastian and Steinert, Wolfgang and Beversdorff, Manfred (2019) The Present Challenge of Transonic Compressor Blade Design. ASME Journal of Turbomachinery, 141 (9), 091004. American Society of Mechanical Engineers (ASME). doi: 10.1115/1.4043329. ISSN 0889-504X. Volltext nicht online. |
| Hergt, Alexander Silvio and Klinner, Joachim and Grund, Sebastian and Willert, Christian and Steinert, Wolfgang and Beversdorff, Manfred (2019) On the Importance of Transition Control at Transonic Compressor Blades. In: ASME Turbo Expo 2019: Turbomachinery Technical Conference and Exposition, GT 2019. ASME Turbo Expo, 2019-06-17 - 2019-06-21, Phoenix, AZ, USA. doi: 10.1115/GT2019-90440. ISBN 978-079185871-4. Volltext nicht online. |
| Hergt, Alexander Silvio and Klinner, Joachim and Grund, Sebastian and Willert, Christian and Steinert, Wolfgang and Beversdorff, Manfred (2021) On the Importance of Transition Control at Transonic Compressor Blades. ASME Journal of Turbomachinery, 143 (031007). American Society of Mechanical Engineers (ASME). doi: 10.1115/1.4049783. ISSN 0889-504X. Volltext nicht online. |
| Hergt, Alexander Silvio and Klinner, Joachim and Willert, Christian and Grund, Sebastian and Steinert, Wolfgang (2022) INSIGHTS INTO THE UNSTEADY SHOCK BOUNDARY LAYER INTERACTION. In: ASME Turbo Expo 2022: Turbomachinery Technical Conference and Exposition, GT 2022, 10-A. ASME Turbo Expo Conference, 2022-06-13 - 2022-06-17, Rotterdam, The Netherlands. doi: 10.1115/GT2022-82720. ISBN 978-079188612-0. Volltext nicht online. |
| Herr, Milena (2017) Implementierung eines Verfahrens zur automatisierten Kennfeldberechnung auf Basis eines Verdichter Meanline-Codes. Bachelor's, Institut für Antriebstechnik. |
| Herrmann, M. and Neise, W. (1995) Experimental Investigation of Noise Sources in Cross-flow Fans. Contract Report to United Technologies Research Center. Carrier Corp., Syracuse, N. Y., 20 November 1995. Volltext nicht online. |
| Herrmann, M. and Neise, W. (1995) Experimental Investigation of Noise Sources in Cross-Flow Fans. DLR-Interner Bericht. 92517-95/B8. 204 S. Volltext nicht online. |
| Herrmann, M. and Neise, W. (1997) Experimental investigation of noise sources in cross-flow fans with different vortex wall shapes. Contract Report to United Technologies Research Center. DLR-Interner Bericht. 92517-97/B6. 188 S. Volltext nicht online. |
| Herrmann, M. and Neise, W. and Enghardt, L. and März, J. (1997) Three-hole probe measurements in cross-flow fan and data summary for technology transfer. Contract Report to United Technologies Research Center. DLR-Interner Bericht. 92517-97/B9. 86 S. Volltext nicht online. |
| Heselhaus, A. (1993) Dreidimensionale Effekte der realen stationaeren Stroemung auf den Waermeuebergang an Turbinenschaufeln. Project Report, DLR-Interner Bericht. Abschlußbericht zum BMFT-Vorhaben 0326500A, AG Turbo, Turbotherm Bauteilkühlung, Vorhaben 2.1.2.1. 54 S. Volltext nicht online. |
| Heselhaus, A. (1995) Gekoppelte Berechnung der Temperaturverteilung in diabat umströmten Körpern. Bauteilen von Gasturbinen", 27.-28. Juli 1995, Berlin. Volltext nicht online. |
| Heselhaus, A. (1996) Gekoppelte Berechnung der Materialtemperaturen in gekuehlten Turbinenschaufeln. Kolloquium Energietechnik, Ruhr-Universitaet Bochum, 1996. Volltext nicht online. |
| Heselhaus, A. (1996) Gekoppelte Berechnung des äußeren Wärmeübergangs und der Materialtemperaturen konvektionsgekühlter Turbinenschaufeln. In: Tagungsband zum 5. Statusseminar der AG-Turbo. 5. Statusseminar der AG-Turbo, 5-6. Dez. 1996, Sekretariat der AG-Turbo, DLR Köln-Porz. Volltext nicht online. |
| Heselhaus, A. (1997) Ein hybrides Verfahren zur gekoppelten Berechnung von Heißgasströmung und Materialtemperaturen am Beispiel gekühlter Turbinenschaufeln. DLR-Forschungsbericht. 97-10. Dissertation. 143 S. Volltext nicht online. |
| Heselhaus, A. (1998) A Hybrid Coupling Scheme and Stability Analysis for Coupled Solid/ Fluid Turbine Blade Temperature Calculations. In: ASME Turbo-Expo 98. ASME Turbo-Expo 98, 2.-5. Juni 1998, Stockholm. Volltext nicht online. |
| Heselhaus, A. (1997) Gekoppelte Berechnung des äußeren Wärmeübergangs und der Materialtemperaturen konvektionsgekühlter Turbinenschaufeln. Project Report, DLR-Interner Bericht. 106 S. Volltext nicht online. |
| Heselhaus, A. and Vogel, D.T. (1995) Numerical Simulation of Turbine Blade Cooling with Respect to Blade Heat Conduction and Inlet Temperature Profiles. c by American Inst. of Aeronautics and Astronautics, Washington D.C.. AIAA paper 95-3041, San Diego, CA, USA. Volltext nicht online. |
| Heselhaus, A. and Vogel, T. and Krain, H. (1992) Coupling of 3D-Navier-Stokes External Flow Calculations and Internal 3D-Heat-Conduction Calculations for Cooled Turbine Blades. In: AGARD-CP AGARD Conference Proceedings, Heat Transfer and Cooling in Gas Turbines. AGARD. ISBN 1. Volltext nicht online. |
| Hoeren, A. (1996) Experimentelle Untersuchung der Auswirkung von Turbulenzerzeugern auf die Kraftstoffdispersion und -verdampfung in einem Vormischkanal. Other. 73 S. Volltext nicht online. |
| Hoffmann, B. (1990) Zur Berechnung raeumlicher, reibungsbehafteter Stroemungen in Turbomaschinen. ABB, 15. November 1990, Baden, Schweiz. Volltext nicht online. |
| Hoffmann, B. and Nürnberger, D. and Weber, A. and Hong Yang, (2003) Strömungssimulation eines Radialverdichter-Laufrades zur Untersuchung des Pumpgrenzbereichs. Project Report, DLR-Interner Bericht. 02-03. 77 S. Volltext nicht online. |
| Hoffmann, B. and Weber, A. and Hong Y., (2004) Strömungssimulation eines Radialverdichter-Laufrades mit Variation der Schaufelhinterkante. DLR-Interner Bericht. 325-11-04. 30 S. Volltext nicht online. |
| Hoffmann, Bettina and Krain, Hartmut (2007) Kompaktdiffusor, Stand der theoretischen und experimentellen Arbeiten. [Other] Volltext nicht online. |
| Hoffmann, S. and Habisreuther, P. and Lenze, B. and Eickhoff, H. (1995) Lean stability limits of turbulent swirling natural gasflames. In: Proc. Int. Gas Research Conf. 1995, Cannes. International Gas Research Conference, Cannes, France. Volltext nicht online. |
| Hoffmann, S. and Lenze, B. and Eickhoff, H. (1997) Results of Experiments and Models for Predicting Stability Limits of Turbulent Swirling Flames. ASME. Volltext nicht online. |
| Hoffmann, S. and Philipp, M. and Lenze, B. and Eickhoff, H. (1991) Experimentelle und numerische Untersuchungen zum Stabilitätsverhalten freibrennender Vormischflammen. In: VDI-Berichte, pp. 463-472. 15. Deutscher Flammentag. Volltext nicht online. |
| Hoffmann, W. (1990) Programmsystem zur numerischen Behandlung stationärer räumlicher Strömungen in Turbomaschinenkomponenten. DLR-Forschungsbericht. 90-18. Dissertation. 157 S. Volltext nicht online. |
| Hollmann, Carsten and Mennicken, Maximilian and Otten, Tom and Schönweitz, Dirk and Wolters, Florian (2019) Evaluation of Boundary Layer Ingestion on Propulsion Level by Coupling of Overall System Analysis and High-Fidelity 3D-CFD Fan Simulation. Deutscher Luft- und Raumfahrtkongress 2019, 2019-09-30 - 2019-10-02, Darmstadt, Germany. Volltext nicht online. |
| Holste, F. (1995) Ermittlung der aerodynamischen Lärmquellen und Berechnung des abgestrahlten Schallfeldes mittels der im Nahfeld gemessenen Druckschwankungen am Beispiel eines Triebwerksmodells. Dissertation, Technische Universität Berlin, Dissertation. Volltext nicht online. |
| Holste, F. (1995) An Equivalent Source Method for Calculation of the Sound Radiated from Aircraft Engines. In: Proc. First CEAS/AIAA Aeroacoustics Conference. DGLR-Bericht 95-01 (1995) 729-738, 17 Bild., 1 Tab., 12 Lit.. First CEAS/AIAA Aeroacoustics Conference (16th AIAA Aeroacoust. Conference), Munich, 12-15 June 1995;. Volltext nicht online. |
| Holste, F. and Neise, W. (1995) Akustische Nahfeldmessungen an einem Triebwerksmodell zur Ermittlung der dominierenden Schallerzeugungsprozesse. In: Fortschritte der Akustik - DAGA '95 (1995), pp. 403-406. DPG GmbH, Bad Honnef 1995. DAGA '95, Saarbrücken, 14.-17.03.1995. Volltext nicht online. |
| Holste, F. and Neise, W. (1995) Acoustical Near Field Measurements on a Propfan Model for Noise Source Identification. In: Proc. First CEAS/AIAA Aeroacoustics Conference . DGLR-Bericht 95-01 (1995) 1221-1229, 6 Bild., 2 Tab., 5 Lit.. First CEAS/AIAA Aeroacoustics Conference (16th AIAA Aeroacoustics Conference), Munich, 12-15 June 1995. Volltext nicht online. |
| Holste, F. and Zhang Y., and Neise, W. (1996) Experimental analysis of acoustical modes generated by the interaction of two non-synchronous rotors. In: Proc. 2nd AIAA/CEAS Aeroacoustics Conference (1996). 2nd AIAA/CEAS Aeroacoustics Conference (17th AIAA Aeroacoustics Conf.), May 6-8, 1996, Penn State University, State College, Penns., USA. Volltext nicht online. |
| Holste, F. (1) (1997) An equivalent source method for calculation of the sound radiated from aircraft engines. Journal of Sound and Vibration 203 (1997) 667-695. Volltext nicht online. |
| Holste, F. (1) and Neise, W. (1997) Noise source identification in a propfan model by means of acoustical near field measurements. Journal of Sound and Vibration 203 (1997) 641-655. Volltext nicht online. |
| Holzknecht, G. (1999) Numerische Simulation des Verhaltens wärmegetauschter Triebwerke für zivile Luftfahrtantriebe. DLR-Interner Bericht. 325-05-99. Diploma. Volltext nicht online. |
| Holzäpfel, Frank and Gerz, Thomas (2008) The DLR Project Wirbelschleppe - Detecting, Characterizing, Controlling, Attenuating, Understanding, and Predicting Aircraft Wake Vortices. DLR-Forschungsbericht. DLR-FB-2008-15. Institut für Physik der Atmosphäre > Wolkenphysik und Verkehrsmeteorologie. 128 S. |
| Hong Yang, (2003) Unsteady Flow Simulation of a Transonic Compressor Coupled with Casing Treatment. In: Proceedings of 11th Annual Conference of CFD Society of Canada. 11th Annual Conference of CFD Society of Canada (CFD2003), Vancouver, B.C., May 28-30, 2003. Volltext nicht online. |
| Hong Yang, and Dirk Nuernberger, and Eberhard Nicke, and Anton Weber, (2003) Numerical Investigation of Casing Treatment Mechanisms with Conservative Mixed-Cell Approach. In: Proceedings of ASME Turbo Expo 2003, Power for Land, Sea, and Air. ASME Turbo Expo 2003, ASME Paper GT2003-38483, Atlana, USA, June 16-19, 2003. Volltext nicht online. |
| Huber, Kerstin Claudie and Loeser, Thomas and Looye, Gertjan and Liersch, Carsten M. and Lindermeir, Erwin and Kemptner, Erich and Klimmek, Thomas and Koch, Stefan and Kuchar, Richard and Nauroz, Mobin and Paul, Michael and Rein, Martin and Rode, Gerald and Rohlf, Detlef and Rütten, Markus and Schütte, Andreas and Schwithal, Jana and Siggel, Martin and Voss, Arne and Zimper, Dirk (2015) Bewertung und Entwurf von agilen und hoch gepfeilten Flugzeugkonfigurationen. DLR-Interner Bericht. DLR-IB 124-2015/913. 120 S. Volltext nicht frei. |
| Huebner, K. (1992) Laseroptische simultane L2F-Partikelgrößen- und Geschwindigkeitsmessung. DLR-SM-AT-Seminar, July 1992. Volltext nicht online. |
| Hummel, F. (2001) Zeitabhängiger Einfluss einer transsonischen Hochdruckturbine auf ein nachfolgendes Leitgitter. DLR-Forschungsbericht. 2001-13. Dissertation. 144 S. Volltext nicht online. |
| Hummel, F. (2001) Wake-Wake Interactions and ITS Potential for Clocking in a Transonic High Pressure Turbine. In: The 46th ASME International Gas Turbine & Aeroengine Technical Congress, ASME TURBO EXPO 2001. ASME TURBO EXPO, New Orleans, 04-07. Juni 2001, New Orleans. Volltext nicht online. |
| Hungenberg, H. and Stursberg, K. (1996) Erhoehung der Lufterhitzerkapazitaet fuer Untersuchungen an schadstoffarmen Brennkammern. DLR-Interner Bericht. 325-03-96. 9 S. Volltext nicht online. |
| Hungenberg, H. and Stursberg, K. and Weyer, H. (1991) Thrust Nozzle Test Facility at DLR Cologne. In: AIAA-91-5024. American Inst. of Aeron. and Astron. Washington, USA. Volltext nicht online. |
| Hungenberg, H.-G. (1998) Ausbau des Zentrums für Verbrennungsforschung, techn. Phase II. DLR-Interner Bericht. 325-10-98. Volltext nicht online. |
| Hungenberg, H.-G. (2000) Ausbau der Infrastruktur des Zentrums für Verbrennungsforschung. DLR-Interner Bericht. 325-01-2000. 15 S. Volltext nicht online. |
| Hungenberg, H.G. and Schimming, P. (1991) Modifizierung des M2VP zur Untersuchung des Hochtemperaturfans eines Hyperschallantriebes BMFT-Förderkonzept Hyperschalltechnologie, Förderkennzeichen HI8901I7. Project Report, DLR-Interner Bericht. 325-07-91. Volltext nicht online. |
| Hungenberg, H.G. and Stursberg, K. (1997) Ausbau des DLR-Verbrennungszentrums DLR-Vorhaben zum Leitkonzept Umweltschonender Antrieb "Engine 3E 2010". DLR-Interner Bericht. 325-02-97. 18 S. Volltext nicht online. |
| Ilic, Caslav and Merle, Andrei and Abu-Zurayk, Mohammad and Görtz, Stefan and Leitner, Martin and Süelözgen, Özge and Kier, Thiemo and Schulze, Matthias and Klimmek, Thomas and Kaiser, Christoph and Quero-Martin, David and Schuster, Andreas and Petsch, Michael and Kohlgrüber, Dieter and Häßy, Jannik and Becker, Richard-Gregor and Gottfried, Sebastian and Fröhler, Benjamin and Hartmann, Johannes and Tröltzsch, Anke (2020) Cybermatrix protocol: a novel approach to highly collaborative and computationally intensive multidisciplinary aircraft optimization. In: AIAA Aviation 2020 Forum. AIAA Aviation Forum 2020, 2020-06-15 - 2020-06-19, virtual event. doi: 10.2514/6.2020-3169. ISBN 978-162410598-2. |
| Iwanizki, Michael and Strack, Matthias and Zimmer, Dirk and Plohr, Martin (2018) Conceptual Design and Preliminary Analysis of Short Range Aircraft Concepts with Hybrid Electric Propulsion. 18. ONERA-DLR Aerospace Symposium (18. ODAS), 2018-05-03 - 2018-05-05, Bonn, Deutschland. (Unpublished) Volltext nicht online. |
| Janicka, J. and Eickhoff, H. and Bauer, W. (1996) Das Cray-Tecflam-Projekt Entwicklung einer modernen, kommerziellen Software fuer technische Verbrennungsprozesse. 12. Tecflam-Seminar, Darmstadt 1996. Volltext nicht online. |
| Jarius, M. (2003) "Particle Image Velocimetry" im rotierenden Kühlkanal. Kolloquium zu Ehren von Prof.Dr.-Ing.G.Winterfeld,Köln,15.Okt.2003. Volltext nicht online. |
| Jarius, M. and Elfert, M. (2002) Steady Fluid Flow investigation using PIV in a multi-pass coolant channel. 11th International Symposium on Applications of Laser Techniques to Fluid Mechanics, Lisbon, 8-11 June, 2002.. Volltext nicht online. |
| Jarius, M.P. and Elfert, M. (2004) Application von PIV und Stereo-PIV an einem Kühlsystem einer Turbinenrotorschaufel mit verrippten Wänden. In: 12.Fachtagung. 12.GALA-Facht. Lasermethoden in der Strömungsmesstechnik,7.-9.Sept. 2004,Karlsruhe. Volltext nicht online. |
| Jarius, M.P. and Elfert, M. (2004) Detailed fflow investigation using PIV in a stationary two-pass cooling geometry. In: Proceedings. 12th Intern.Symp. on Aplications of Laser Techniques to Fluid Mechanics,12-15.July,2004,Lisbon,Portugal. Volltext nicht online. |
| Jarius, P.M. and Elfert, M. (2003) Flow investigation in a two-pass coolant channel with/ without ribbed walls. In: Proceedings. 16th Int.Symp.on Air Breathing Engines,Aug.31-Sept.5,2003 Cleveland,Ohio,USA. Volltext nicht online. |
| Jaron, Robert (2024) EU Projekt SENECA. DLRK 2024, 2024-09-30, Hamburg, Deutschland. (Unpublished) Volltext nicht online. |
| Jaron, Robert and Moreau, Antoine and Guerin, Sebastien and Enghardt, Lars and Lengyel, Timea and Otten, Tom and Nicke, Eberhard (2020) Multidisciplinary Design Optimization of a Low-Noise and Efficient Next-Generation Aero-Engine Fan. In: ASME Turbo Expo 2020: Turbomachinery Technical Conference and Exposition, GT 2020. ASME Turbo Expo 2020: Turbine Technical Conference and Exposition, 2020-06-22 - 2020-06-26, London (online). doi: 10.1115/GT2020-14580. ISBN 978-079188419-5. Volltext nicht online. |
| Jaron, Robert and Viola, Nicole (2024) The Future of Cicil Supersonic Transport in Europe: The SENECA and MORE&LESS Projects. In: 34th Congress of the International Council of the Aeronautical Sciences, ICAS 2024. ICAS 2024, 2024-09-09 - 2024-09-13, Florenz, Italien. doi: 10.71945/icas2024_0820. ISSN 2958-4647. |
| Jawtusch, V. (1990) Verlustberechnungen fuer das Verdichtergitter MAN GHH 1-S1. Vergleich zwischen Messung und Rechnung. DLR-Interner Bericht. 325-01-90. 51 S. Volltext nicht online. |
| Jawtusch, V. (1993) Verbesserte Verlustberechnungen fuer die superkritischen Verdichtergitter SKG-FVV 3.3 und SKG-FVV 4.1; Vergleich zwischen Messung und Rechnung. DLR-Interner Bericht. 325-07-93. 73 S. Volltext nicht online. |
| Jawtusch, Vera (1994) Verlustberechnungen fuer die Verdichtergitter GHH-RAS92 und GHH-LNS92. Vergleich mit Messergebnissen. DLR-Interner Bericht. 325-01-94. 86 S. Volltext nicht online. |
| Jentink, H.W. and Beversdorff, M. and Foerster, W. (1995) Laser Anemometry for In-Flight Flow Investigations. 16th ICIASF 1995 (International Congress on Instrumentation in Aerospace Simulation Facilities), July 18-21, 1995, Dayton, Ohio, USA. Volltext nicht online. |
| Josuhn-Kadner, B. and Hoffmann, B. (1993) Investigations on a Radial Compressor Tandem Rotor Stage with Adjustable Geometry. Journal of Turbomachinery, Transactions of the ASME 115 (1993) 3, 115, pp. 552-559. ASME, New York, USA. Volltext nicht online. |
| Junker, Martin (2017) Numerische Untersuchung des Betriebsverhaltens eines Radialverdichters bei nicht idealer Anströmung. Bachelor's, FH Aachen University of Applied Sciences. Volltext nicht online. |
| Jöcker, M. and Freudenreich, K. and Fransson, T.H. and Rehder, H.-J. (2000) Parametric studies of the aerodynamic excitation in high pressure turbines. 9th International Symposium on Unsteady Aerodynamics, Aeroacoustics and Aeroelasticity of Turbomachines (ISUAAAT), Lyon/France, 4.-8. September 2000, Frankreich. Volltext nicht online. |
| Jöcker, M. and Kessar, A. and Fransson, T. and Kahl, G. and Rehder, H.-J. (2003) Comparison of Models to Predict Low Engine Order Excitation in a High Pressure Turbine Stage. 10th International Symposium on Unsteady Aerodynamics, Aeroacoustics and Aeroelasticity in Turbomachines, Durham NC, USA, Sept. 7-11 2003, Durham, NC USA. Volltext nicht online. |
| Jägersküpper, Jens (2022) Schlussbericht zum DLR-Beitrag "Skalierbare Numerikverfahren für Aerodynamiksimulationen" ("SIENA") im LuFo-V-3-Verbund "Hochskalierbare parallele Methoden für die numerische Simulation in der Luftfahrttechnologie für eine massive Digitalisierung in der Fluggeräte- und Triebwerksentwicklung" ("Towards highly scalable algorithms for numerical simulations in aeronautics": "TOSCANA"), Laufzeit: 1/2018-12/2021. Project Report. Förderkennzeichen BMBF 20X1704A. Other. Technische Informationsbibliothek (TIB) Hannover. 71 S. Volltext nicht frei. |
| Kaeufer, B. (1997) Entwurf und Konstruktion eines Luftstromzerstaeubers und dessen Integration in eine Vorverdampferduese. DLR-Interner Bericht. 325-08-97. 99 S. Volltext nicht online. |
| Kajasa, Bojan and Lengyel, Timea and Meyer, Robert (2022) Numerical and Experimental Design of a radial displaceable Inlet Distortion Device. In: 25th ISABE. International Society of Air Breathing Engines, 25th Conference, 2022-09-25 - 2022-09-30, Ottawa, Kanada. Volltext nicht frei. |
| Kallergis, K. (1993) Experimentelle Untersuchungen der Sprayeigenshcaften verschiedener Zerstaeuberduesen und -konfigurationen unter erhoehtem Druck. Diploma. Volltext nicht online. |
| Kallergis, K.M. (1996) Zur Problematik der Halon-Ersatzstoffe in der Luftfahrt. 5. Workshop NBL, Oberhof, 30.-31. Jan. 1996. Volltext nicht online. |
| Kallergis, K.M. (1995) Testing of Halon-Replacements on Aircraft Interior Fires. International Halon Replacement Working Group Meeting, Atlantic City, USA, November 17, 1995. Volltext nicht online. |
| Kallergis, K.M. (1995) Definition von Anforderungen an Halon-Ersatzstoffe zur Brandbekämpfung in Flugzeugen. Project Report, DLR-Interner Bericht. 41 S. Volltext nicht online. |
| Kallergis, K.M. (1995) DLR Halon Replacement-Trials, State of the Art. International Halon Replacement Working Group Meeting, Rome, Italy, April 19-20, 1995. Volltext nicht online. |
| Kallergis, K.M. (1996) Extinguishing of Aircraft Interior Fires with Halon Replacements for Handheld Extinguishers. AGARD-Symp. "Aircraft Fire Safety", Okt. 1996, Dresden. Volltext nicht online. |
| Kallergis, K.M. (1997) Definition von Anforderungen an Halon-Ersatzstoffe zur Brandbekaempfung in Flugzeugen. Project Report, DLR-Interner Bericht. 26 S. Volltext nicht online. |
| Kallweit, Stephan and Dues, Michael and Müller, Ulli and Lederer, Thomas and Schroll, Michael and Willert, Christian (2007) Einsatz der Particle Image Velocimetry zur Untersuchung von Rohrströmungen. In: Lasermethoden in der Strömungsmesstechnik, 15. Fachtagung der GALA, 35.1-35.8. Lasermethoden in der Strömungsmesstechnik, 15. Fachtagung der GALA, 2007-09-04 - 2007-09-06, Rostock. ISBN ISBN 978-3-86009-007-7. Volltext nicht frei. |
| Kallweit, Stephan and Willert, Christian and Dues, Michael and Müller, Ulrich and Lederer, Thomas (2008) PIV for volume flow metering. 14th International Symposium on Applications of Laser Techniques to Fluid Mechanics, 2008-07-07 - 2008-07-10, Lisbon (Portugal). |
| Kameier, F. and Neise, W. (1995) Experimental Study of Tip Clearance Losses and Noise in Axial Turbomachines. VDI-Tagung Turbomachinery - Fluid Dynamic and Thermodynamic Aspects, 1-3 March 1995, Dahlewitz. Volltext nicht online. |
| Kameier, F. and Neise, W. (1995) Reduction of Tip Clearance Loss and Tip Clearance Noise in Axial Flow Machines. In: Proc. AGARD PEP 85th Meeting on Loss Mechanisms and Unsteady Flows in Turbomachines 1995. AGARD PEP 85th Meeting on Loss Mechanisms and Unsteady Flows in Turbomachines, Derby, UK, 8-12 May 1995. Volltext nicht online. |
| Kameier, F. and Neise, W. (1995) Rotating Blade Flow Instability as a Source of Noise in Axial Turbomachines. In: Proc. First CEAS/AIAA Aeroacoustics Conference. DGLR-Bericht 95-01, pp. 157-166. First CEAS/AIAA Aeroacoustics Conference (16th AIAA Aeroacoust. Conference, Munich, 12-15 June 1995. Volltext nicht online. |
| Kameier, F. and Neise, W. (1997) Experimental study of tip clearance losses and noise in axial turbomachinery and their reduction. Journal of Turbomachinery 119 (1997) 460-471. Volltext nicht online. |
| Kameier, F. (1) and Neise, W. (1997) Rotating blade flow instability as a source of noise in axial turbomachines. Journal of Sound and Vibration 203 (1997) 833-853. Volltext nicht online. |
| Kameier, F. (1) and Neise, W. and Schuch, A. (2) (1996) Einfluss der Schaufelzahl und der Kopfspaltweite auf den Spitzenwirbellaerm axialer Stroemungsmaschinen. In: VDI-Bericht 1249 (1996) 75-79. VDI-GET-Tagung "Ventilatoren im industriellen Einsatz III", Braunschweig, 28.-29.2.1996. Volltext nicht online. |
| Karpinski, G. (2000) Drei-Komponenten-Doppler-Laser-zwei-Fokus-Geschwindigkeitsmeßsystem für berührungslose Messung der Strömungsgeschwindigkeit an besonders schwer zugänglichen Stellen. DLR-Forschungsbericht. 2000-25. Dissertation. 117 S. Volltext nicht online. |
| Kasper, Aaron (2019) STTF Uni Bochum: Experimental Investigation of an Inter Compressor Duct. Symposium on Turbomachinery Test Facilities, 2019-05-21 - 2019-05-22, Bochum, Deutschland. |
| Kasper, Aaron and Dygutsch, Thomas and Grund, Sebastian and Hakansson, Sebastian and Nicke, Eberhard and Beversdorff, Manfred (2022) Experimental Investigation of an Aggressive S-Shaped Intermediate Compressor Duct. In: ASME Turbo Expo 2022: Turbomachinery Technical Conference and Exposition, GT 2022. ASME Turbo Expo 2022, 2022-06-13 - 2022-06-17, Rotterdam, The Netherlands. doi: 10.1115/GT2022-82449. ISBN 978-079188612-0. Volltext nicht online. |
| Keppel, W. and Weyer, H.B. (1995) Präsentation TURBOFLAM. Außerordentliche Sitzung des VGB-Fachausschusses "Vergasungsanlagen" VGB-Haus, VGB-Essen, 24.08.1995. Volltext nicht online. |
| Kersken, Hans-Peter and Schreiber, Andreas and Strietzel, Martin and Faden, Michael and Ahrem, Regine and Post, Peter and Wolf, Klaus and Beckert, Armin and Gerholt, Thomas and Heinrich, Ralf and Kügeler, Edmund (2000) AMANDA - A Distributed System for Aircraft Design. In: Euro-Par 2000 - Parallel Processing: 6th International Euro-Par Conference, 1900, pp. 1315-1322. Springer-Verlag. Euro-Par 2000, 2000-08-29 - 2000-09-01, München, Deutschland. Volltext nicht online. |
| Kersken, Hans-Peter and Ashcroft, Graham and Frey, Christian and Pütz, Oliver and Stüer, Heinrich and Schmitt, Stefan (2012) Validation of a Linearized Navier-Stokes Based Flutter Prediction Tool Part1: Numerical Methods. ASME Turbo Expo 2012, 2012-06-11 - 2012-06-15, Kopenhagen, Dänemark. doi: 10.1115/GT2012-68018. Volltext nicht online. |
| Kessar, A. and Joecker, M. and Fransson, T. and Rehder, H.-J. and Kost, F. (2005) Flow Measurements for Low Engine Order Excitations in a High Pressure Turbine Stage. 6th European Conference on Turbomachinery - Fluid Dynamics and Thermodynamics , Lille France, March 15, 2005, Frankreich. Volltext nicht online. |
| King, W. F. III (1996) A précis of developments in the aeroacoustics of fast trains. Journal of Sound and Vibration, 193, pp. 349-358. Volltext nicht online. |
| King, W. F. III (1996) Rapporteur's Report: Session 5. Journal of Sound and Vibration 193 (1996) 387-389.. Volltext nicht online. |
| King III, W. F. (1995) A Brief Survey of Developments in the Aeroacoustics of Fast Trains. In: Proc. 5th Int. Workshop on Railway- and Tracked Systems Noise (1995). 5th Int. Workshop on Railway- and Tracked Systens Noise, Voss, Norway, 21-24 June 1995. Volltext nicht online. |
| King III, W. F. (1995) Radiated Aerodynamic Noise Generated by High-Speed Tracked Vehicles. Transportation Research Record No. 1475, National Res. Council Washington, DC, 1995, pp. 59-65. National Academic Press. Volltext nicht online. |
| King III, W. F. (1996) Aerodynamic noise sources on high-speed trains. Harris, Miller, Miller and Hanson Inc., 22 June 1996.. Volltext nicht online. |
| King III, W. F. and Herrmann, M. and Neuhaus, L. and Pfizenmaier, E. (1996) Aeroakustische Untersuchungen an modifizierten Auflaufhoernern und Hubbegrenzungsbuegeln fuer den DSA-350-SEK-Stromabnehmer. DLR-Interner Bericht. 92517-96/B6. 67 S. Volltext nicht online. |
| King III, W. F. and Herrmann, M. and Neuhaus, L. and Pfizenmaier, E. (1996) Experimentelle akustische Untersuchungen an 1:10 Modellkomponenten des ICE 2.2 im akustischen Windkanal der DLR in Braunschweig. DLR-Interner Bericht. 92517-96/B7. 24 S. Volltext nicht online. |
| King III, W. F. and Herrmann, M. and Pfizenmaier, E. (1996) Aeroakustische Untersuchungen an modifizierten Auflaufhoernern und Hubbegrenzungsbuegeln fuer den DSA-350-SEK-Stromabnehmer (vorl. Bericht). DLR-Interner Bericht. 92517-96/B3. 17 S. Volltext nicht online. |
| King III, W. F. and Pfizenmaier, E. (1995) Statusbericht über Schallquellmechanismen an Hochgeschwindigkeitsstromabnehmern und Maßnahmen zu deren Reduktion. DLR-Interner Bericht. 92517-95/B4. 75 S. Volltext nicht online. |
| King III, W. F. and Pfizenmaier, E. and Barsikow, B. (1) and Herrmann, M. and Klemenz, M. (1) and Neuhaus, L. and Schüttpelz, M. (1) (1996) Experimentelle akustische Untersuchungen an 1:10 Modellkomponenten des ICE 2.2 im akustischen Windkanal der DLR in Braunschweig. DLR-Interner Bericht. 92517-96/B10, Teile I und II (1996). 164 S. Volltext nicht online. |
| King III, W. F. and Pfizenmaier, E. and Herrmann, M. (1996) Acoustical investigations of a full-scale DSA-350-SEK pantograph in an anechoic open-jet wind tunnel. DLR-Interner Bericht. 92517-96/B4. 70 S. Volltext nicht online. |
| King III, W. F. and Pfizenmaier, E. and Herrmann, M. (1996) On abating aerodynamic sound generated by components of high-speed pantographs. DLR-Interner Bericht. 92517-96/B9. 16 S. Volltext nicht online. |
| King III, W. F. and Pfizenmaier, E. and Herrmann, M. and Neuhaus, L. (1996) An experimental study of sound generated by flow interactions with cylinders. DLR-Interner Bericht. 92517-96/B11. 91 S. Volltext nicht online. |
| King III, W. F. and Pfizenmaier, E. and Neuhaus, L. (1995) Experimental Investigations of 1:10 ICE 2.2 Models in the Aeroacoustic Windtunnel (AWB) of the DLR in Braunschweig. DLR-Interner Bericht. 92517-95/B9. 73 S. Volltext nicht online. |
| King III, W. F. and Pfizenmaier, E. and Neuhaus, L. (1995) Experimentelle Untersuchungen an 1:10-Modellen des ICE 2.2 im Akustik-Windkanal der DLR in Braunschweig (Schlussbericht). DLR-Interner Bericht. 92517-95/B10. 131 S. Volltext nicht online. |
| King III, W.F. (1997) Sound generated by flow interactions with slender bodies and its abatement. 2nd International Workshop on the Aeroacoustics of High-Speed Trains, Berlin, 29.4.1997. Volltext nicht online. |
| King III, W.F. and Pfizenmaier, E. and Herrmann, M. (1997) Schallquellen an Hochgeschwindigkeitsstromabnehmern und Moeglichkeiten zu deren Reduktion. DLR-Interner Bericht. 92517-97/B1. 119 S. Volltext nicht online. |
| Klevenz, T. (1996) Berechnung und Analyse des Brennkammerzustandes in kryogenen Hockdruck-H2/O2-Raketentriebwerken. Project Report. 54 S. Volltext nicht online. |
| Kliebisch, Oliver (2020) Das Potential optischer Messtechniken für die Flugsensorik. Angewandte Forschung für Verteidigung und Sicherheit in Deutschland, 2020-03-03 - 2020-03-05, Bonn, Deutschland. Volltext nicht online. |
| Kliebisch, Oliver and Mahnke, Peter and Lorbeer, Raoul-Amadeus and Miller, Nico and Damm, Matthias and Fischer, Michael and Stockhausen, Guido and Beversdorff, Manfred and Burow, Eike (2020) Das Potential optischer Messtechniken für die Flugsensorik. Deutscher Luft- und Raumfahrtkongress 2020, 2020, Online-Konferenz. Volltext nicht online. |
| Klinner, Joachim (2017) Development and assessment of volume resolving velocimetry for turbomachinery test facilities. DLR-Forschungsbericht. DLR-FB-2017-52. Dissertation. University of Kassel. 194 S. |
| Klinner, Joachim and Freitag, Stefan and Hassa, Christoph and Willert, Christian (2017) Implementation of tomographic shadowgraphy in a generic aero engine burner at elevated pressure and temperature. Measurement and Observation Techniques for Aerospace Research (MOTAR), 2017-04-26 - 2017-04-27, Berlin. Volltext nicht frei. |
| Klinner, Joachim and Munoz Lopez, Edwin Joseph and Hergt, Alexander and Willert, Christian (2024) The unsteady Shock - Boundary Layer Interaction in a Compressor Cascade - Part 1: Measurements with time-resolved PIV. In: 69th ASME Turbo Expo 2024: Turbomachinery Technical Conference and Exposition, GT 2024, GT2024-124307. ASME Turbo Expo 2024 Turbomachinery Technical Conference and Exposition GT2024, 2024-06-24 - 2024-06-28, London, United Kingdom. doi: 10.1115/GT2024-124307. ISBN 978-079188807-0. Volltext nicht frei. |
| Klinner, Joachim and Willert, Christian (2017) Measurements of Turbulent Jet Mixing in a Turbulent Co-Flow Including the Influence of Periodic Forcing and Heating. Flow Turbulence and Combustion, 98 (3), pp. 751-779. Springer. doi: 10.1007/s10494-016-9789-3. ISSN 1386-6184. Volltext nicht frei. |
| Klinner, Joachim and Willert, Christian and Förster, Wolfgang and Beversdorff, Manfred and Mayer, Valentin (2015) Simultaneous PLIF/PIV measurements of pulsating and heated coaxial jets in a turbulent channel flow. In: 8th International Symposium on Turbulence, Heat and Mass Transfer (THMT 2015), 8, pp. 195-198. Begell House inc., New York, Wallingford (UK). 8th International Symposium on Turbulence, Heat and Mass Transfer, 2015-09-15 - 2015-09-18, Sarajevo. doi: 10.1615/ichmt.2015.thmt-15.290. ISSN 2377-2816. Volltext nicht frei. |
| Klose, Björn and Morsbach, Christian and Bergmann, Michael and Munoz Lopez, Edwin Joseph and Hergt, Alexander and Kügeler, Edmund (2024) The Unsteady Shock-Boundary Layer Interaction in a Compressor Cascade – Part 2: High-Fidelity Simulation. In: 69th ASME Turbo Expo 2024: Turbomachinery Technical Conference and Exposition, GT 2024, 12D. ASME Turbo Expo 2024: Turbomachinery Technical Conference and Exposition, 2024-06-24 - 2024-06-28, London, UK. doi: 10.1115/GT2024-124264. ISBN 978-079188807-0. Volltext nicht frei. |
| Klose, Björn and Morsbach, Christian and Bergmann, Michael and Munoz Lopez, Edwin Joseph and Hergt, Alexander and Kügeler, Edmund (2024) The Unsteady Shock-Boundary Layer Interaction in a Compressor Cascade - Part 2: High-Fidelity Simulation. ASME Journal of Turbomachinery. American Society of Mechanical Engineers (ASME). doi: 10.1115/1.4067097. ISSN 0889-504X. |
| Klähn, Lukas and Moreau, Antoine and Caldas, Luciano and Tapken, Ulf (2022) Assessment of in-duct fan broadband noise measurements in a modern low-speed test rig. In: International Conference of Fan Noise, Aerodynamics, Applications and Systems 2022. International Conference of Fan Noise, Aerodynamics, Applications and Systems 2022, 2022-04-06, Senlis, Frankreich. doi: 10.26083/tuprints-00021709. |
| Koene, E. (2001) DatPWG - Design of the Data Acquisition for a New Large Scale Facility for Aerodynamics and Heat Transfer Measurements on a Turbine Platform. DLR-Interner Bericht. 225-2001 A 07. 40 S. Volltext nicht online. |
| Kompenhans, J. and Schröder, A. and Raffel, M. and Kähler, C. and Arnott, A. and Bao, F. and Sammler, B. and Schneider, G. and Stasicki, B. and Frahnert, H. and Klinge, F. and Vollmers, H. and Agocs, J. and Mattner, H. and Stanislas, M. and Hinsch, K. and Westerweel, J. and Willert, C. and Ehrenfried, K. and Micknaus, I. and Rosenstock, C. and Henze, D. (2003) Application of Particle Image Velocimetry, Theory and Practice. In: Application of Particle Image Velocimetry, Theory and Practice, Ordner-. PIV-Course, Göttingen, Germany, 03.03.-07.03.2003. Volltext nicht online. |
| Kompenhans, J. and Schröder, A. and Raffel, M. and Kähler, C. and Arnott, A. and Bao, F. and Sammler, B. and Schneider, G. and Stasicki, B. and Frahnert, H. and Kuduz, M. and Klinge, F. and Vollmers, H. and Agocs, J. and Mattner, H. and Stanislas, M. and Hinsch, K. and Westerweel, J. and Willert, C. and Micknaus, I. and Rosenstock, C. (2002) Application of Particle Image Velocimetry, Theory and Partice. In: Application of Particle Image Velocimetry, Theory and Partice, Ordner-. PIV-Course, Göttingen, Germany, 04.03.-08.03.2002. Volltext nicht online. |
| Kompenhans, Jürgen and Dieterle, Lutz and Richard, Hugues and Dewhirst, T. and Vollmers, Heinrich and Kähler, Christian and Ehrendfried, Klaus and Ronneberger, Olaf and Willert, Christian and Pengel, Kurt (2000) Measurement of flow fields with Particle Image Velocimetry. In: Progress in Vehicle Aerodynamics, pp. 131-157. Expert Verlag, 71272 Renningen. EUROmotor Short course, Progress in Vehicle Aerodynamics - Advanced Experimental Techniques, 2000-03-29 - 2000-03-30, Stuttgart (Germany). ISBN 3-8169-1843-3. Volltext nicht online. |
| Kompenhans, Jürgen and Raffel, Markus and Dieterle, Lutz and Dewhirst, T. and Vollmers, Heinrich and Kähler, Christian and Schröder, Andreas and Ronneberger, Olaf and Ehrenfried, Klaus and Willert, Christian and Pengel, Kurt (2000) Particle Image Velocimetry in Aerodynamics: Technology and Applications in Wind Tunnels. Journal of Visualization, Vol. 2 (No. 3/4), pp. 229-244. Volltext nicht online. |
| Kompenhans, Jürgen and Raffel, Markus and Dieterle, Lutz and Dewhirst, T. and Vollmers, Heinrich and Stuff, Roland and Schneider, G. and Kähler, Christian and Ronneberger, Olaf and Willert, Christian and Pengel, Kurt and de Gregorio, F. and Monnier, J. C. (2000) Application of PIV in Large Wind Tunnels. In: Particle Image Velocimetry and Associated Techniques Lecture Series 2000-01, VKI LS 200-01. von Karman Institute, Belgium. 27Seiten. ISBN ISSN 0377-8312. Volltext nicht online. |
| Kompenhans, Jürgen and Schröder, Andreas and Willert, Christian and Kähler, Christian (2009) The development of Particle Image Velocimetry towards a versatile experimental tool for turbulence research. Solving the Riddle of Turbulence: What, Why, and How?, 2009-05-06 - 2009-05-09, Göttingen, Germany. Volltext nicht online. |
| Kompenhans, Jürgen and Raffel, Markus and Dieterle, Lutz and Willert, Christian and Kähler, Christian and Richard, Huge and Schröder, Andreas and Vollmers, Heinrich and Schneider, Gert and Stasicki, Boleslaw and Agocs, Janos and Micknaus, Ilka and Stanislas, Michel and Hinsch, Klaus and Westerweel, Jerry (2000) Application of Particle Image Velocimetry - Theory and Partice. Course Notes, Ordner. Volltext nicht online. |
| Konle, Holger and Rausch, Anne and Fischer, Andre and Doll, Ulrich and Willert, Christian and Paschereit, Oliver and Roehle, Ingo (2009) Development of optical measurement techniques for thermo-acoustic diagnostics: fibre-optic microphone, Rayleigh-scattering, and acoustic PIV. International Journal of Spray and Combustion Dynamics, 1 (2), pp. 251-282. SAGE Publications. ISSN 1756-8277. Volltext nicht online. |
| Koopman, J. (1997) Numerische und experimentelle Untersuchung zweier Fett-Mager Brennkammern. DGLR-Fachausschuss-Sitzung "Schadstoffarme Verbrennung in Fluggasturbinen", Dresden, 6.-7. Nov. 1997. Volltext nicht online. |
| Koopman, J. (1991) CFD-Applications for Combustion Chamber Flows. R&D Working Group "Airbreathing Propulsion" in the BMFT Hypersonic Techn. Progr., Vortr. 18.03.91 TU Stuttgart. Volltext nicht online. |
| Koopman, J. (1991) CFD-Applications for Combustion Chamber Flows. R&D Working Group "Airbreathing Propulsion" in the BMFT HTP, an der TU Stuttgart am 18.03.1991. Volltext nicht online. |
| Koopman, J. and Fischer, M. and Magens, E. and Winandy, A. and Meislitzer, B. (1996) Potential Use of Hydrogen in Propulsion. Subtask "Non Intrusive Measurements". Project Report, DLR-Interner Bericht. 57 S. Volltext nicht online. |
| Koopman, J. and Griebel, P. and Hassa, C. (1996) Numerical and Experimental Investigation of a Rich Quench Lean Combustor Sector. ASME, NY, USA. ASME-96-GT48, International Gas Turbine and Aeroengine Congress, Birmingham, UK, June 10-13, 1996. Volltext nicht online. |
| Koopman, J. and Rachner, M. and Wiegand, H. and Eickhoff, H. (1990) Aerodynamics and Stabilization of Combustion of Hydrogen Jets Injected into Subsonic Airflow. In: AGARD Conference Proceedings No. 479 "Hypersonic Combined Cycle Airflow".. Volltext nicht online. |
| Koopman, J. and Rachner, M. and Wiegand, H. and Eickhoff, H. (1990) Aerodynamics and Stabilization of Combustion of H2-Jets Injected into Subsonic Airflow. AGARD 75th Symposium of the PEP on Hypersonic Combined Cycle Propulsi on 1990. Volltext nicht online. |
| Koopman, J. and Stursberg, K. (1990) The New Nozzle Test Facility at the DLR Koeln. 2nd Meeting of the R&D Support Group "Aerothermodynamics of Combustio n Chamber and Nozzles", RWTH Aachen, 8 October 1990. Volltext nicht online. |
| Koopman, J.W. and Hassa, Ch. and Griebel, P. and Theisen, P. (1998) Investigation of a Rectangular Rich-Quench-Lean Combustor Sector. ASME. 43rd ASME Gas Turbine and Aeroengines Congress, Stockholm, Schweden, June 1998. Volltext nicht online. |
| Koopman, Johannes and Hassa, Christoph (2004) Numerical Design of an Axially Staged Low Emission Gas Turbine Combustor. In: Proceedings: Trends in Numerical and Physical Modelling of Turbulent Processes in Gasturbine Combustors, 2, pp. 119-124. 2nd (International) SBF568-WORKSHOP : Trends on Numerical and Physical Modelling of Turbulent Processes in Gas Turbine Combustors, Heidelberg, April 1, 2 - 2004. Volltext nicht online. |
| Kost, F. (2001) Experimental Investigation of the Flow Field within the Honda-ES-Rotor at the Windtunnel for Rotating Cascades (RGG). DLR-Interner Bericht, Project Report. 225-2001 C 05. 92 S. Volltext nicht online. |
| Kost, F. (2001) Messungen am ebenen Turbinengitter BRR-HP1 mit Ausblasen aus Reihe SS3. DLR-Interner Bericht, Project Report. 225-2001 C 02. 80 S. Volltext nicht online. |
| Kost, F. (2004) Low Reynolds Number Rotor Tests for the Honda-ALR-Profile at the Windtunnel for Rotating Cascades (RGG). DLR-Interner Bericht. 225-2003 C 02. 126 S. Volltext nicht online. |
| Kost, F. (2003) Experimental Investigation of Flow and Endwall Heat Transfer at Siemens-NGF-50-Cascade. DLR-Interner Bericht. 225-2003 C 03. 52 S. Volltext nicht online. |
| Kost, F. (2004) Experimental Investigation of the Flow Field within a Turbine Rotor Cascade with Rear Pressure Side Coolant Ejection. Appendix A. DLR-Interner Bericht. 225-2004 C02A. 99 S. Volltext nicht online. |
| Kost, F. (2004) Experimental Investigation of the Flow Field within a Turbine Rotor Cascade with Rear Pressure Side Coolant Ejection. DLR-Interner Bericht. 225-2004 C02. 33 S. Volltext nicht online. |
| Kost, F. (2004) Experimental Investigation of the Flow Field within a Turbine Stator Cascade. DLR-Interner Bericht. 225-2004 C 09. 62 S. Volltext nicht online. |
| Kost, F. (2005) Eichung einer Kulite-Pitotsonde und Beschreibung der Auswerteprozedur. DLR-Interner Bericht. 225-2005 A 03. 33 S. Volltext nicht online. |
| Kost, F. (2005) Überprüfung der Kalibration einer 4-Loch-Sonde. DLR-Interner Bericht. 225-2005 C 06. 21 S. Volltext nicht online. |
| Kost, F. and Gieß, P.-A. (2004) Experimental Turbine Research at DLR Göttingen. Journal of the Gas Turbine Society of Japan, Vol. 32 (No. 6), pp. 47-56. Volltext nicht online. |
| Kost, F. and Hamkar, A. M. (2004) Experimental Investigation of the Flow Field within a Turbine Stator Cascade. Appendix A: Results without Coolant Ejection. DLR-Interner Bericht. 225-2004 C09 A. 95 S. Volltext nicht online. |
| Kost, F. and Hamkar, A.W. and Mullaert, A. (2005) Messung der Geschwindigkeit und der Kühlluftkonzentration mit Hilfe des L2F-Gerätes bei Plattformkühlung eines Turbinenstators. DLR-Interner Bericht. 225-2004 A 07. 71 S. Volltext nicht online. |
| Kost, F. and Nicklas, M. (2001) Film-Cooled Turbine Endwall in a Transonic Flow Field. Part I - Aerodynamic Measurements. In: ASME TURBO EXPO 2001. ASME TURBO EXPO 2001, New Orleans, USA, 4.-7. Juni 2001, New Orleans, USA. Volltext nicht online. |
| Kost, F. and Willburger, A. (2003) Experimental Investigation of Flow and Endwall. Appendix A. DLR-Interner Bericht. 225-2003 C 03A. 118 S. Volltext nicht online. |
| Kozulovic, D. and Röber, T. K. and Kügeler, E. and Nürnberger, D. (2004) Modifications of a Two-Equation Turbulence Model for Turbomachinery Fluid Flows. In: DGLR Jahrbuch, 1 und 2. DGLR. Deutscher Luft- und Raumfahrtkongress, Dresden, 20.09.2004. Volltext nicht online. |
| Krain, H. (1998) Kennfeld- und Lasermessungen mit abgedrehtem Laufrad SRV2. FVV-Arbeitskreissitzung "Transsonische Radialverdichter", TU Hannover, 27. März 1998. Volltext nicht online. |
| Krain, H. (1998) Meßergebnisse an der modifizierten Radialverdichterstufe mit beschaufeltem Diffusor. FVV-Arbeitskreissitzung "Transsonische Lauf-Leitradinteraktion bei Radialverdichtern", DLR, Köln, 4. Nov. 1998. Volltext nicht online. |
| Krain, H. (1999) High Pressure Ratio Centrifugal Compressor with Transonic Flow. Proceedings of the 3rd ASME/ISME Joint Fluids Eng. Conference, July 18-23, 1999. Volltext nicht online. |
| Krain, H. (1999) Analysis of Transonic Flow Fields inside a High Pressure Ratio Centrifugal Compressor at Design and Off Design Conditions. In: ASME-Paper, 99-GT-446, 15-. ASME, Indianapolis, June 1999. Volltext nicht online. |
| Krain, H. (1999) Transsonische Lauf-Leitrad Interaktion bei Radialverdichtern. In: Informationstagung Turbinen, pp. 69-83. FVV-Frühjahrstagung, Frankfurt, 14.4.1999. Volltext nicht online. |
| Krain, H. (1999) Messung der instationären Strömung im Eintrittsbereich eines beschaufelten Diffusors. FVV-Arbeitskreissitzung, Berlin, 16.03.99. Volltext nicht online. |
| Krain, H. (2000) Unsteady Diffusor Flow in a Transonic Centrifugal Compressor. Proceedings of the 8th International Symposium on Transport Phenomena and Dynamics of Rotating Machinery (ISROMAC, 26-30 March 2000, Honolulu, USA. Volltext nicht online. |
| Krain, H. (2000) Instationäre Diffusorströmung. FVV-Arbeitskreissitzung "Transsonische Lauf-Leitrad Interaktion bei Radialverdichtern, DLR-Köln, 14. März 2000. Volltext nicht online. |
| Krain, H. (2001) Transsonische Lauf-/Leitrad Interaktion bei Radialverdichtern. Forschungsvereinigung Verbrennungskraftmaschinen, Deutschland. FVV-Abschlussbericht, 2001. Volltext nicht online. |
| Krain, H. (2001) Unsteady Diffuser Flow of a Transonic Centrifugal Compressor. In: Symposium on Air Breathing Engines, pp. 1-9. 15th International Symposium on Air Breathing Engines, ISABE, Bangalore, India, 3.-7. Sept. 2001. Volltext nicht online. |
| Krain, H. (2002) Investigations of the Flow through a High Pressure Ratio Centrifugal Impeller. In: ASME Turbo Expo, CD, pp. 1-9. ASME, Atlanta, USA. ASME Turbo Expo 2002, Amsterdam, Netherlands, June 3-6, 2002. Volltext nicht online. |
| Krain, H. (2002) Unsteady Diffuser Flow in a Transonic Centrifugal Compressor. International Journal of Rotating Machinery, 8 (3), pp. 223-231. Volltext nicht online. |
| Krain, H. (2003) Review of Centrifugal Compressor's Application and Development. ASME. Volltext nicht online. |
| Krain, H. (2004) Homogene Lauf-/Leitradströmung: Stand der experimentellen Arbeiten. Arbeitskreissitzung "Radialverdichter", Köln, 18.02.2004. Volltext nicht online. |
| Krain, H. (2002) Homogene Lauf-/Leitradströmung: Festlegung der Radgeometrie des SRV4. Arbeitskreissitzung "Radialverdichter", Köln, 14.11.2002. Volltext nicht online. |
| Krain, H. (1989) Survey of the DLR-Centrifugal Compressor Research Activities. Seminarvortrag bei: KHD-Luftfahrttechnik GmbH, Oberursel, 1. Jun. 1989, Sundstrand Corporation, Rockford, Illionois, USA, 9. Jun. 1989, Garrett Engine Division, Phoenix, Arizona, USA, 12. Jun. 1989. Volltext nicht online. |
| Krain, H. (1989) Entwurfsverfahren für hochbelastete Radialverdichter. Seminarvortrag, 13.Dezember 1989. Volltext nicht online. |
| Krain, H. (1988) Design Procedure for Centrifugal Impellers. Seminarvortrag, 15. Sept. 1988. Volltext nicht online. |
| Krain, H. (1988) Experimental and Theoretical Investigation of the Flow in Centrifugal Compressors. In: Advanced Centrifugal Compressor Performance Course Notes, Sept. 1988, pp. 1-62. Seminar. Volltext nicht online. |
| Krain, H. (1988) Swirling Impeller Flow. Transact. of the ASME, Journal of Turbomachinery, Vol. 110, pp. 122-128. Volltext nicht online. |
| Krain, H. (1987) Secondary Flow Measurements with L2F Technique in Centrifugal Compressors. AGARD Proceedings, AGARD CP-421 (PEP Meeting, 69th Symposium, Paris, France, 4.-8. Mai 1987), 34.1-34.10. Volltext nicht online. |
| Krain, H. (1987) DFVLR Centrifugal Compressor Research Activities. Seminarvortrag gehalten bei: General Electric, Lynn, Ma., USA, 28.5.1987, Turbomach, San Diego, Ca., USA, 8.6.1987. Volltext nicht online. |
| Krain, H. (1987) Swirling Impeller Flow. American Society of Mechanical Engineering, ASME-Paper (87-GT-19), pp. 1-8. Volltext nicht online. |
| Krain, H. (1987) Experimental and Theoretical Analysis of Centrifugal Compressor Impeller Flow. In: Proceedings of the Institution of Mechanical Engineers, pp. 199-210. I Mech E, Robinson College, Cambridge, England, 1.-3. Sept. 1987. Volltext nicht online. |
| Krain, H. (1987) Auslegung von Radialrädern: Programmbeschreibung. DLR-Interner Bericht. 325-11-87. 18 S. Volltext nicht online. |
| Krain, H. (1986) Experimental Analysis and Prediction of the Flow Field inside Cemtrifugal Compressor Impellers. In: Centrifugal Compressor Design and Performance. Seminar on: Centrifugal Compressor Design and Performance, DFVLR-Köln, June 13-20, 1986. Volltext nicht online. |
| Krain, H. (1986) Sekundärströmungsanalyse in Radialverdichtern. Fachkolloquium. 25 Jahre DFVLR-Antriebstechnik in Köln-Porz. Volltext nicht online. |
| Krain, H. (1986) Auslegungsverfahren für Radialräder hohen Druckverhältnisses. Zentrumskolliquium DFVLR-AVA. Göttingen, 23. Okt. 1986. Volltext nicht online. |
| Krain, H. (1986) Überprüfung eines Aslegungsverfahrens für Radialräder mit Hilfe experimenteller Ergebnisse. In: Berechnung von Strömungen in Turbomaschinen und Vergleich mit experimentellen Untersuchungen. Fachtagung Nr.: T-30-809-051-6. Volltext nicht online. |
| Krain, H. (1985) Experimentelle Analyse der Strömung in Radialrädern und Neuauslegung mit Hilfe eines CAD-Systems. Seminarvortrag, TH-Aachen, 31. Okt. 1985. Volltext nicht online. |
| Krain, H. (1985) Auslegung von Radialrädern mit Hilfe der EDV. Seminarvortrag an der Universität der Bundeswehr, Hamburg, 24. Juni 1985. Volltext nicht online. |
| Krain, H. (1985) DFVLR-Centrifugal Compressor Activities. Seminarvortrag, gehalten bei: United Technologies Research Center, Hartford, Conn., USA, 11.03.1985, NASA Lewis, Cleveland, Ohio, USA, 13.03.1985, Sundstrand Corporation, Rockford, Illinois, USA, 15.03.1985, Solar Turbines, San Diego, Calif., USA, 25.03.. Volltext nicht online. |
| Krain, H. (1985) Interdependence of Centrifugal Compressor Blade Geometry and Relative Flow Field. ASME-Paper, 85-GT-95, pp. 1-7. Volltext nicht online. |
| Krain, H. (1985) Ergebnisse der Kennfeldmessungen am neuen rückwärtsgekrümmten Radialrad. FVV-Arbeitskreis "Radialverdichter", TU-Hannover, 5. Febr. 1985. Volltext nicht online. |
| Krain, H. (1984) Experimental Observation of the Flow in Impellers and Diffusers. In: Flow in Centrifugal Compressors LS-1984-07, VKI-Lecture Series 1984-07. VKI. ISBN 1. Volltext nicht online. |
| Krain, H. (1984) A CAD Method for Centrifugal Compressor Impellers. Transactions of the ASME, Transactions of the ASME, Journal of Engineering for Gas Turbines and Power (Vol. 106, Appr. 1984), pp. 482-488. Volltext nicht online. |
| Krain, H. (1983) Erweiterung des Auslegungsverfahrens für rückwärtsgekrümmte Radialräder hohen Druckverhältnisses. DLR-Interner Bericht. 325-11-83. 69 S. Volltext nicht online. |
| Krain, H. (1983) A CAD-Method for Centrifugal Compressor Impellers. ASME-Paper, 83-GT-65, pp. 1-7. Volltext nicht online. |
| Krain, H. (1983) Laser Measurements within a Centrifugal Compressor and Centrifugal Impeller Design. Seminar, Cleveland, Ohio, USA, 24. March 1983. Volltext nicht online. |
| Krain, H. (1982) Experimental and Theoretical Investigation on the Fluid Dynamics of a Centrifugal Compressor Stage. In: Proceedings of CASI, 1982 1982, 1. CASI. ISBN 1. Volltext nicht online. |
| Krain, H. (1982) The DFVLR-Centrifugal Compressor Activities. Seminarvortrag, gehalten bei: General Electric, Lynn, Mass., USA, 27.04.1982, Pratt&Whittney, Montreal, Canada, 29.04.1982, Detroit Diesel Allison, Indianapolis, USA, 07.05.1982. Volltext nicht online. |
| Krain, H. (1982) Grenzschichtrechenverfahren und ihre Anwendung im Radialverdichter. Seminarvortrag, Institut für Antriebstechnik, DFVLR-Köln. Volltext nicht online. |
| Krain, H. (1982) Auslegungsverfahren für Radialverdichterlaufräder mit CAD/CAM-Unterstützung. FVV-Arbeitskreissitzung Radialverdichter. Volltext nicht online. |
| Krain, H. (1981) Ein Auslegungsverfahren für rückwärtsgekrümmte Radialräder hohen Druckverhältnisses. DLR-Interner Bericht. 325-13-1981. 157 S. Volltext nicht online. |
| Krain, H. (1981) Analyse von Strömungsvorgängen in Radialverdichtern und Folgerungen für die Auslegung. Triebwerkskolloquium: 20 Jahre Triebwerksforschung in Köln-Porz, 10. Dez. 1981. Volltext nicht online. |
| Krain, H. (1981) A Study on Centrifugal Impeller and Diffuser Flow. Transactions of the ASME, Journal for Engineering for Power (Volume 103, Number 4, October 1981), pp. 688-697. Volltext nicht online. |
| Krain, H. (1981) Radialverdichterauslegung für Turboaufladung mit Zusatzantrieb bei begrenzter Drehzahl. Seminarvortrag, DFVLR-Köln. Volltext nicht online. |
| Krain, H. (1981) Centrifugal Compressor Research Activities at DFVLR Cologne. Seminar, Garrett Turbines, Phoenix, AZ., USA, 5. March 1981. Volltext nicht online. |
| Krain, H. (1981) Studie zur Turboaufladung eines PKW-Dieselmotors mit Zusatzantrieb. Project Report, DLR-Interner Bericht. ohne. Volltext nicht online. |
| Krain, H. (1980) Experimental and Theoretical Investigations on the Internal Flow in a Centrifugal Compressor Diffuser. In: Centrifugal Compressors, Flow Phenomena and Performance AGARD Conference Proceedings, AGARD-CP-282. AGARD. ISBN 1. Volltext nicht online. |
| Krain, H. (1979) Ergebnisse der Leistungsmessungen an einer Radialverdichterstufe mit beschaufeltem Diffusor. FVV-Arbeitskreissitzung "Radialverdichter", Köln, 13. Nov. 1979. Volltext nicht online. |
| Krain, H. (1979) Erste experimentelle und theoretische Ergebnisse der Untersuchungen an einer Radialverdichterstufe mit beschaufeltem Diffusor. DLR-Interner Bericht. 352-79/9. 33 S. Volltext nicht online. |
| Krain, H. (1979) Experimentelle und theoretische Arbeiten am Radialverdichter der DFVLR. FVV-Arbeitskreissitzung, TU-Hannover, 13.03.1979. Volltext nicht online. |
| Krain, H. (1979) Das integrale Grenzschichtverfahren Walz II, seine numerische Behandlung und vergleichende Rechenergebnisse. DLR-Interner Bericht. 352-79/1. 47 S. Volltext nicht online. |
| Krain, H. (1978) Laufende Forschungsarbeiten am Radialverdichter der DFVLR. FVV-Arbeitskreissitzung, ETH-Zürich, 6. Okt. 1978. Volltext nicht online. |
| Krain, H. (1978) Auslegung einer Radialverdichterstufe hohen Druckverhältnisses, insbesondere im Hinblick auf den beschaufelten Diffusor. DLR-Interner Bericht. 352-78-9. 104 S. Volltext nicht online. |
| Krain, H. (1997) Transsonische Radialverdichter. Seminarvortrag, Universität Karlsruhe, 22. Jan. 1997. Volltext nicht online. |
| Krain, H. (1983) Erweiterung des Auslegungsverfahrens für rückwärtsgekrümmte Radialräder hohen Druckverhältnisses. DLR-Interner Bericht. 325-11-83. 69 S. Volltext nicht online. |
| Krain, H. (2004) Homogene Lauf-/Leitradströmung, Experimentelle Ergebnisse mit dem SRV4. FVV-Sitzung Radialverdichter, 20.10.2005. Volltext nicht online. |
| Krain, H. (2005) Review of Centrifugal Compressor's Application and Development. In: Transactions of the ASME, Journal of Turbomachinery January 2005, Volume 127, pp. 25-34. ASME. ISBN 1. Volltext nicht online. |
| Krain, H. (1975) Beitrag zur Berechnung der quasi-dreidimensionalen Strömung in Radialverdichter-Laufrädern. Dissertation, RWTH-Aachen. Volltext nicht online. |
| Krain, H. (1990) 3D-Stroemungsrechnungen in Turbomaschinen. Seminarvortrag bei ABB, 15. November 1990, Baden, Schweiz. Volltext nicht online. |
| Krain, H. (1990) Experimemntal and Theoretical Analysis of the Flow in Centrifugal Compressors. 1990 ASME/IGTI Fluid Dynamics of Turbomachinery Program, 13-23 August 1990, Ames, Iowa. Volltext nicht online. |
| Krain, H. (1991) Future DLR-Turbomachinery Research. ERCOFTAC-Meeting on Internal Flows in Turbomachines, Grenoble (F), 24./25.01.91. Volltext nicht online. |
| Krain, H. (1991) Analyse der Radialverdichterströmung. Fachkolloquium RWTH-Aachen, Aachen, 15.02.91. Volltext nicht online. |
| Krain, H. (1991) Erläuterungen zur Auslegung des ersten Läufers für den neuen Radialverdichterprüfstand der DLR. FVV-Arbeitsskreissitzung, DLR-Köln, 22.04.91. Volltext nicht online. |
| Krain, H. (1991) Stand der experimentellen Arbeiten am schnellaufenden Radialverdichter. FVV-Arbeitskreissitzung bei der DLR-Köln, 23.10.91. Volltext nicht online. |
| Krain, H. (1991) Centrifugal Compressor Flow Analysis Measurement and Calculation. Seminarvortrag ONERA-Besuch bei DLR-Köln, 05.12.91. Volltext nicht online. |
| Krain, H. (1992) High pressure ratio compressors. Short Course on Design of Radial and Mixed Flow Compressors, Cranfield Inst. of Technology, 2.-6.03.92, Cranfield, UK. Volltext nicht online. |
| Krain, H. (1992) Kennfeldmessungen an einem Laufrad mit hohem Druckverhältnis. FVV-Arbeitskreissitzung "Radialverdichter hoher Schluckfähigkeit", 05.02.92, BMW-RR, Oberursel. Volltext nicht online. |
| Krain, H. (1992) Test Case 2: Centrifugal Impeller. In: European Research Community on Flow Turbulence and Combustor (ERCOFTAC), Turbomachinery Special Interest Group. Seminar and Workshop on "3D Turbomaschinery Flow Prediction", 07.12.92, France. Volltext nicht online. |
| Krain, H. (1992) Meßergebnisse mit dem SRV1-Rad. FVV-Arbeitskreissitzung "Radialverdichter hoher Schluckfähigkeit", 16.09.92 bei Sulzer-Escher-Wyss, Zürich, Schweiz. Volltext nicht online. |
| Krain, H. (1993) Messungen an einem Radialrad mit transsonischer Anstroemung. Seminarvortrag 28.04.1993, ABB Baden, Baden/Schweiz. Volltext nicht online. |
| Krain, H. (1993) Fertigung des Laufrades SRV2 und Modifikationen am Radialverdichterpruefstand. FVV-Arbeitskreissitzung "Radialverdichter hoher Schluckfaehigkeit" 17.02.1993, DLR-Koeln. Volltext nicht online. |
| Krain, H. (1993) Centrifugal Compressor Activities at DLR. Seminarvortrag 01.Juni 9193, United Technologies Research Center East Hartford, Connecticut, USA. Volltext nicht online. |
| Krain, H. (1993) Abschliessende Lasermessungen am SRV1 und erste Messergebnisse fuer das Laufrad SRV2. FVV-Arbeitskreissitzung "Radialverdichter hoher Schluckfaehigkeit" 29.Okt. 1993, Frankfurt. Volltext nicht online. |
| Krain, H. (1993) Validation Test Case for Threedimensional Unsteady Calculations. NREC-Workshop on "Design and Development of Centrifugal Compressors", New York 9-10.93, Milan, Italy. Volltext nicht online. |
| Krain, H. (1994) Erste 3D-Rechenergebnisse fuer ein Radialverdichterlaufrad mit zurueckgeschnittenen Schaufeln und transsonischer Anstroemung. FVV-Arbeitskreissitzung "Radialverdichter hoher Schluckfaehigkeit", 21.04.1994, DLR Koeln. Volltext nicht online. |
| Krain, H. (1994) Centrifugal Impeller, Test Case II. ERCOFTAC, Seminar and Workshop on 3D Turbomachinery Flow PredictionII 10-13 January 1994, Val d'Isere, France. Volltext nicht online. |
| Krain, H. (1994) Vergleich zwischen 3D-Rechenergebnissen und Lasermessungen fuer ein Radialrad mit transsonischer Anstroemung. FVV-Arbeitskreissitzung "Radialverdichter hoher Schluckfaehigkeit", 27.10.1994, GHH Oberhausen. Volltext nicht online. |
| Krain, H. (1994) Auslegung eines beschaufelten Diffusors fuer einen Radialverdichter mit hohem Stufendruckverhaeltnis. FVV-Arbeitskreissitzung "Radialverdichter hoher Schluckfaehigkeit", 14.12.1994, DLR-Koeln. Volltext nicht online. |
| Krain, H. (1995) Test Case II: "Centrifugal Impeller". ERCOFTAC, Seminar and Workshop on 3D Turbomachinery Flow Prediction II, 9-12 January 1995, Les Arcs, France. Volltext nicht online. |
| Krain, H. (1995) Auslegung eines Radialdiffusors mit transsonischer Anströmung. FVV-Arbeitskreissitzung "Radialverdichter", 30. März 1995, TU Berlin. Volltext nicht online. |
| Krain, H. (1995) Radialverdichter hoher Schluckfähigkeit. FVV-Informationstagung Turbinen, 5. April 1995, Frankfurt am Main. Volltext nicht online. |
| Krain, H. (1995) Reasearch on High Pressure Ratio Impellers. Seminarvortrag, NASA-Lewis, Cleveland, Ohio, USA, 1. Juni 1995. Volltext nicht online. |
| Krain, H. (1996) High Pressure ratio centrifugal compressors: design and research. Colloquium on Turbomachinery 1996, May 5-8 1996, Seoul National University, Korea. Volltext nicht online. |
| Krain, H. (1996) Aerodynamics of a Centrifugal Compressor with Transonic Flow. Symposium on Turbomachinery Research, RWTH Aachen, March 21 and 22, 1996. Volltext nicht online. |
| Krain, H. (1996) Forschungsvereinigung Verbrennungskraftmaschinen-Radialverdichter hoher Schluckfaehigkeit. In: Proc. Informationstagung Turbinen der FW, Heft R 487 (1996), pp. 127-144. Forschungsvereinigung Verbrennungskraftmasch. e.V. Frankfurt a. Main. Informationstagung Turbinen der FVV, Frühjahr 96, Heft R487,Abschlußbericht über das Vorhaben "Radialverdichter hoher Schluckfähigkeit".. Volltext nicht online. |
| Krain, H. (1996) Vergleich der 3D-Rechenergebnisse fuer die Laufraeder SRV2 und SRV3. FVV-Arbeitskreissitzung "Radialverdichter hoher Schluckfaehigkeit", MAN/B&W, Augsburg, 24.4.1996. Volltext nicht online. |
| Krain, H. (1996) Lasermessungen am SRV3 Laufrad und 3D-Rechenergebnisse. FVV-Arbeitskreissitzung "Radialverdichter" bei Holset Engineering Deutschland GmbH, Dresden, 7. Nov. 1996. Volltext nicht online. |
| Krain, H. (1998) Radialverdichter mit transsonischer Strömung. Kolloquium Fluid- und Thermodynamik, Universität-Gesamthochschule Siegen, 6.2.1998. Volltext nicht online. |
| Krain, H. (1998) Kennfeld- und Lasermessungen an schaufellosem, schrägem Diffusor. FVV-Arbeitskreissitzung "Transsonische Radialverdichter", DLR-Koeln, 21. Jan. 1998. Volltext nicht online. |
| Krain, H. (1997) Experimentelle Untersuchungen an einer transsonischen Radialverdichterstufe mit beschaufeltem Diffusor. FVV-Arbeitskreis "Transsonische Radialverdichter", PGW-Leipzig, 5. Nov. 1997. Volltext nicht online. |
| Krain, H. (1997) Lasermeßergebnisse für das Radialrad SRV3. FVV-Arbeitskreis "Radialverdichter mit hoher Schluckfähigkeit", 22. April 1997, ABB-Baden, Schweiz. Volltext nicht online. |
| Krain, H. and Eckardt, D. (1978) The Flow Field in a High Speed Centrifugal Compressor Impeller. A Comparison of Experimental and Theoretical Results. First International Conference on Centrifugal Compressor Technology, Feb. 20.-23rd 1978. Volltext nicht online. |
| Krain, H. and Hah, C. (2003) Numerical and Experimental Investigation of the Unsteady Flow Field in a Transonic Centrifugal Compressor. In: The International Gas Turbine Congress 2003, Tokyo, Japan, IGTC'03 Tokyo, pp. 1-9. The International Gas Turbine Congress 2003, Tokyo, Japan. Volltext nicht online. |
| Krain, H. and Hoffmann, B. (1998) Aerodynamics of a Centrifugal Compressor Impeller with Transonic Inlet Conditions. ASME Summer Meeting, Washington DC, June 1998. Volltext nicht online. |
| Krain, H. and Hoffmann, B. (2003) Zwischenbericht über das Vorhaben Nr.: 798 "Homogene Lauf-Leitradströmung im Radialverdichter". Project Report. Heft R 522. Forschungsvereinigung Verbrennungskraftmaschinen (FVV). Volltext nicht online. |
| Krain, H. and Hoffmann, B. (1996) Aerodynamics of Centrifugal Compressors with Transonic Flow. In: VKI-Lecture Series 1996-01, "Flow in Radial Turbomachines". von Karman Inst. for Fluid Dynamics, Brussels, Belgium. Volltext nicht online. |
| Krain, H. and Hoffmann, B. and Pak, H. (1995) Aerodynamics of a Centrifugal Compressor Impeller with Transonic Inlet Conditions. In: ASME, Houston, Texas, June 5-8, 1995.. American Society of Mechanical Engineers, Atlanta, Georgia, USA. Volltext nicht online. |
| Krain, H. and Hoffmann, B. and Rohne, K.-H. and Eisenlohr, G. and Richter, F.-A. (2007) Improved High Pressure Ratio Centrifugal Compressor. In: ASME TURBO EXPO 2007, pp. 1-9. ASME TURBO EXPO 2007, 2007-05-14 - 2007-05-17, Montreal, Kanada. Volltext nicht online. |
| Krain, H. and Hoffmann, B. and Vogel, T. and Weber, A. (1998) Auslegung einer neuen radialen Endstufe für die Gasturbine THM 1304-10. Project Report, DLR-Interner Bericht. 325-09-98. Volltext nicht online. |
| Krain, H. and Hoffmann, W. (1989) Verification of an Impeller Design by Laser Measurements and 3D-Viscous Flow Calculations. ASME Paper, ASME (89-Gt-159), pp. 1-8. Volltext nicht online. |
| Krain, H. and Hoffmann, W. (1989) Centrifugal Impeller Geometry and its Influence on Secondary Flows. AGARD Conference Proceedings, AGARD CP (74th PEP-Meeting, Luxemburg), pp. 1-5. Volltext nicht online. |
| Krain, H. and Hoffmann, W. (1990) High Pressure Ration Centrifugal Compressors: Design and Flow Analysis. In: Proceedings; DGLR-Bericht 90-01 (1990).. DGLR, Bonn. European Propulsion Forum 1990 "Future Civil Engines and the Protection of the Atmosphere", 3-5 April 1990, Koeln-Porz.. Volltext nicht online. |
| Krain, H. and Karpinski, G. and Beversdorff, M. (2001) Flow Analysis in a Transonic Centrifugal Compressor Rotor Using 3-Component Laser Velocimetry. In: ASME Turbo Expo 2001, pp. 1-12. The American Society of Mechanical Engineers, Atlanta, USA. ASME-Tagung, New Orleans, USA, June 2001. Volltext nicht online. |
| Krain, H. and Lecht, M. and Plohr, M. (2001) Analyse des Betriebsverhaltens von Turboladern zur Hochdruckaufladung von Dieselmotoren. DLR-Interner Bericht. 325-06-01. 37 S. Volltext nicht online. |
| Krain, H. and Pak, H. and Hoffmann, B. (1994) Flow Field Analysis in a High Pressure Ratio Centrifugal Compressor. In: AGARD Paper, 82nd Symposium, 04.-08. Oktober 1993, Montreal, Canada. Volltext nicht online. |
| Krain, H. and Rogge, H. (1985) Auslegung und Fertigung von Radialrädern hohen Druckverhältnisses. In: Thermische Strömungsmaschinen 85 572.1, Band 1. Verein Deutscher Ingenieure. ISBN 1. Volltext nicht online. |
| Krain, H. and Rymenants, E. (1978) Ein FORTRAN-Programm zur Berechnung der Hauptabmessungen und des Betriebsverhaltens einer hoch belasteten Radialverdichterstufe. DLR-Interner Bericht. 352-78-10. 93 S. Volltext nicht online. |
| Krain, H. and Schodl, R. and Binder, A. and Dunker, R. (1986) Success in the Application of Laser Velocimetry in Turbomachinery Studies. In: Advanced Experimental Techniques in Turbomachinery Concepts, ETI. 5-1-5-22. ISBN 1. Volltext nicht online. |
| Krain, H. and Schodl, R. and Binder, A. and Dunker, R. (1985) Success in the Application of Laser-Velocimetry to Turbomachinery Studies. Seminar on Advanced Turbomachinery, Universität der Bundeswehr, München, 20.-24. May, 1985. Volltext nicht online. |
| Krain, Hartmut (2005) Kennfeldmessergebnisse für eine hoch belastete Radialverdichterstufe, FVV-Arbeitskreissitzung, Köln. [Other] Volltext nicht online. |
| Krain, Hartmut (2006) Transsonische Radialverdichter. [Other] Volltext nicht online. |
| Krain, Hartmut (2007) Survey of Turbomachinery Research at DLR. Chinese Academy of Sciences, Institute of Engineering Thermophysics, Beijing 100080, China. Seminar, 2007-09-10, Peking, China. Volltext nicht online. |
| Krain, Hartmut (2008) Lärmoptimierter Radialverdichter großer Kennfeldbreite. FVV-Arbeitskreissitzung Radialverdichter, 2008-01-22, Frankfurt/Main. Volltext nicht online. |
| Krain, Hartmut (2008) Kennfeldmessungen am SRV4 mit Kompaktdiffusor. Project Report. Forschungsvereinigung Verbrennungskraftmaschinen (FVV), Frankfurt/Main. 63 S. Volltext nicht online. |
| Krain, Hartmut (2008) Kennfeldmessungen am SRV4 mit Kompaktdiffusor. In: ProMeta, FVV-Projektcenter im Internet. FVV-Arbeitskreissitzung Radialverdichter, LärmIII, 2008-08-26, Berlin. Volltext nicht online. |
| Krain, Hartmut (2008) Heron ganz im Heute, mit Turbokraft die Umwelt schonen. DLR-Mitteilung. DLR-Nachrichten September 2008/ G 12625. Volltext nicht online. |
| Krain, Hartmut (2008) Stand der Arbeiten am SRV4 mit Kompaktdiffusor. Forschungsvereinigung Verbrennungskraftmaschinen. [Other] Volltext nicht online. |
| Krain, Hartmut (2009) Centrifugal Compressor Research at DLR. In: Kyushu University. Graduate School of Engineering Sciences. International Symposium on Transonic Centrifugal Compressors, 2009-01-21, Fukuoka, Kasuga, Kyushu University, Japan. Volltext nicht online. |
| Krain, Hartmut and Hoffmann, Bettina (2005) Homogene Lauf-/ Leitradströmung im Radialverdichter. In: Informationstagung Turbinen, Herbst 2005, R532-2005, Köln, pp. 67-94. Forschungsvereinigung Verbrennunskraftmaschinen. Informationstagung Turbinen, 2005-09-28, Köln (Deutschland). Volltext nicht online. |
| Krain, Hartmut and Hoffmann, Bettina (2005) Homogene Lauf-/Leitradströmung. Project Report. Volltext nicht online. |
| Krain, Hartmut and Hoffmann, Bettina (2005) Lasermess- und 3D-Rechenergebnisse für einen transsonischen Rotor. FVV-AK-Sitzung, S. 1-66, Köln. [Other] Volltext nicht online. |
| Krain, Hartmut and Hoffmann, Bettina (2007) Flow Study of a Redesigned High Pressure Ratio Centrifugal Compressor. In: American Institute of Aeronautics and Astronautics Inc., ISABE-2007 (1223), pp. 1-9. 18th ISABE Conference, 2007-09-02 - 2007-09-07, Beijing, China. Volltext nicht online. |
| Krain, Hartmut and Hoffmann, Bettina (2008) Kompaktdiffusor. In: FVV-Frühjahrstagung 2008, Heft R542-2008, pp. 131-153. Informationstagung Turbomaschinen, 2008-04-03, Frankfurt/Main. Volltext nicht online. |
| Krain, Hartmut and Hoffmann, Bettina (2008) Ergebnisse der Untersuchungen am SRV4 mit Kompaktdiffusor. [Other] Volltext nicht online. |
| Krain, Hartmut and Hoffmann, Bettina (2008) Flow Study of a Redesigned High Pressure Ratio Centrifugal Compressor. AIAA Journal, Volume 24, Number 5, Oct. 2008, p. 7. American Institute of Aeronautics and Astronautics. Volltext nicht online. |
| Krain, Hartmut and Hoffmann, Bettina and Beversdorff, Manfred (2007) Flow Pattern at the Inlet of a Transonic Centrifugal Rotor. International Gas Turbine Congress 2007 Tokyo, 2007-12-02 - 2007-12-07, Tokyo, Japan. Volltext nicht online. |
| Krain, Hartmut and Hoffmann, Bettina and Voges, Melanie (2006) Tischvorlage, FVV-Arbeitskreissitzung. Project Report. Other. 83 S. Volltext nicht online. |
| Krain, Hartmut and Hoffmann, Bettina and Voges, Melanie (2006) Tischvorlage FVV-AK-Sitzung Sept. 2006. Project Report. 55 S. Volltext nicht online. |
| Krain, Hartmut and Hoffmann, Bettina and Voges, Melanie (2007) FVV-AK-Sitzung, Tischvorlage. Forschungsvereinigung Verbrennungskraftmaschinen, Frankfurt/M. [Other] Volltext nicht online. |
| Krain, Hartmut and Hoffmann, Bettina and Voges, Melanie (2007) Tischvorlage, AK-Sitzung 7.11.2007. [Other] Volltext nicht online. |
| Krain, Hartmut and Hoffmann, Bettina and Voges, Melanie (2009) Kompaktdiffusor. In: FVV Informationstagung Turbomaschinen, Frühjahrstagung 2009, Heft R546. Forschungsvereinigung Verbrennungskraftmaschinen. FVV Frühjahrstagung 2009, 2009-04-02, Bad Neuenahr. Volltext nicht online. |
| Krajewski, E. (1994) Leistungsanalyse von Staustrahlantrieben mit Ueberschallverbrennung. DGLR-Jahrestagung 1993, Göttingen, Oktober 1993. Volltext nicht online. |
| Krajewski, E. and Kremer, F. and Winterfeld, G. (1993) Untersuchungen zur Auslegung von SCRAMJET-Antrieben. DGLR-Jahrestagung, 1993, Goettingen. Volltext nicht online. |
| Krajewski (Winterfeld), E. (1992) Leistungsanalyse von Staustrahlantrieben mit Ueberschallverbrennung im Machzahlbereich bon 5 bis 15. DLR-Interner Bericht. 325-10-92. SM-TAT. 178 S. Volltext nicht online. |
| Kremer, F. (1990) Flugleistungsrechnungen für den Staustrahlantrieb eines Raumtransporters. Vortrag an der RWTH Aachen im Rahmen der Vortragsveranstaltung "Ausgewählte Kapitel der Strahlantriebe", 18. Januar 1990, Aachen. Volltext nicht online. |
| Kremer, F. (1990) Einfache Bahnoptimierungsbetrachtungen fuer Reise- und beschleunigte supersonische Flugpunkte mit Staustrahltriebwerken. DLR-Interner Bericht. 325-03-90. 54 S. Volltext nicht online. |
| Kremer, F. (1990) Modellbeschreibung eines Ramjets. DLR-Interner Bericht. 325-09/90. Volltext nicht online. |
| Kremer, F. (1993) Heat Addition in a Non-Constant Area Supersonic Combustor. AIAA/DGLR Fifth International Aerospace Planes and Hypersonics Technology Conference, 30.11.-03.12.93, Munich, Germany. Volltext nicht online. |
| Kremer, F. (1994) Beschreibung von Ueberschallstaubrennkammerprozessen mittels eines eindimensionalen Modells. Seminar DLR-Lampoldshausen, 16.03.1994. Volltext nicht online. |
| Kremer, F. (1993) Eindimensionale Brennkammerbetrachtungen fuer ein SCRAMJET. Gastvortrag im Rahmen der Vorlesung "Ausgewaehlte Kapitel der Strahlantriebe", RWTH Aachen, 09.Feb. 1994. Volltext nicht online. |
| Kremer, F. G. J. (1994) Leistungsanalyse von Stauantrieben fuer Hyperschallfluggeraete. Institutsüberprüfung SM-AT, 20.01.93, Köln-Porz. Volltext nicht online. |
| Kremer, F. G. J. and Winterfeld, G. (1995) Leistungsanalyse von Dual-Mode-Scramjet-Antrieben für einstufige Raumtransporter im Bereich der Flugmachzahlen von 3,8 bis 13. DLR-Forschungsbericht. 95-47. 122 S. Volltext nicht online. |
| Kremer, F.G.J. (1991) Momentenhaushalt und statische Längsstabilität eines hypersonischen FLugkörpers mit Staustrahltriebwerk mit Unterschallverbrennung. DLR-Interner Bericht. 325-11-91. 70 S. Volltext nicht online. |
| Kremer, F.G.J. (1991) Flugmechanikmodell für Leistungsrechnungen und Wechselwirkungen zwischen Flugkörper und Staustrahltriebwerk mit Unterschallverbrennung in bezug zur Flugbahn. DLR-Forschungsbericht. 91-03. 94 S. Volltext nicht online. |
| Kremer, F.G.J. (1991) Thermodynamische Strömungsbeschreibung eines Staustrahltriebwerks mit Unterschallverbrennung zur Bestimmung der Triebwerkskräfte und Momente. DLR-Forschungsbericht. 91-02. Dissertation. 155 S. Volltext nicht online. |
| Kremer, F.G.J. (1994) Eindimensionale Brennkammerbetrachtungen für ein Scramjet. Gastvortrag im Rahmen der Vorlesung "Ausgewählte Kapitel der Strahlantriebe", RWTH Aachen, 9. Februar 1994. Volltext nicht online. |
| Kremer, F.G.J. (1994) Beschreibung von Überschallstaubrennkammerprozessen mittels eines eindimensionalen Modells. Seminarvortrag am 16.03.1994 in der DLR Lampoldshausen. Volltext nicht online. |
| Kremer, F.G.J. (1994) System Analysis for Hypersonic Vehicles with Dual Mode Ram-Scramjet. Liepmann Ludwig Seminar, Caltech, USA, 14. Juni 1994.. Volltext nicht online. |
| Kremer, F.G.J. (1994) Zur Auslegung von Flugkoerpern mit Scramjet-Antrieb. Promotionsvortrag RWTH Aachen, 22. April 1994.. Volltext nicht online. |
| Kremer, F.G.J. (1994) Eindimensionale Brennkammerbetrachtungen fuer ein Staustrahltriebwerk mit Ueberschallverbrennung. DLR-Forschungsbericht. 94-06. Dissertation. 173 S. Volltext nicht online. |
| Krumme, Alexander and Buske, Clemens and Bachner, Johannes Ricco and Dähnert, Jerrit and Tegeler, Marc and Ferraro, Federica and Gövert, Simon and Kocian, Frank and di Mare, Francesca and Pahs, Andreas (2019) Investigation of Combustor-Turbine-Interaction in a Rotating Cooled Transonic High-Pressure Turbine Test Rig Part 1: Experimental Results. In: ASME Turbo Expo 2019: Turbomachinery Technical Conference and Exposition, GT 2019. ASME Turbo Expo 2019: Turbomachinery Technical Conference & Exposition, 2019-06-17 - 2019-06-21, Phoenix, Arizona, USA. doi: 10.1115/GT2019-90733. ISBN 978-079185871-4. Volltext nicht online. |
| Kruse, H. and Lecht, M. (1990) Gasturbinen-Entwicklungsperspektiven einer erprobten Technologie. In: Proceedings. ASUE. Turbo-KWK 90, Kraft-Waerme-Kupplung mit Gasturbinen. Int. Fachtagung der ASUE, 11.-12. Dezember 1990, Darmstadt. Volltext nicht online. |
| Krzikalla, Olaf and Rempke, Arne and Bleh, Alexander and Wagner, Michael and Gerhold, Thomas (2021) Spliss: A Sparse Linear System Solver for Transparent Integration of Emerging HPC Technologies into CFD Solvers and Applications. In: 22nd STAB/DGLR Symposium on New Results in Numerical and Experimental Fluid Mechanics XIII, pp. 635-645. Springer International Publishing. STAB-Symposium 2020, 2020-07-15, Germany. doi: 10.1007/978-3-030-79561-0_60. ISBN 978-3-030-79560-3. ISSN 1612-2909. Volltext nicht online. |
| Krüger, Franziska (2012) Entwicklung von parallelisierbaren Gradienten-basierten Verfahren zur automatisierten, Ersatzmodell-gestützten Optimierung unter Nebenbedingungen für CFD-FEM-Verdichterdesign. Master's, Technische Universität Berlin. |
| Krüger, Wolf R. and Gerlinger, Berit and Brodersen, Olaf and Klimmek, Thomas and Günther, Yves (2020) KonTeKst – Konfigurationen und Technologien für Kurzstreckenflugzeuge. DLR-Interner Bericht. DLR-IB-AE-GO-2020-53. Deutsches Zentrum für Luft- und Raumfahrt. 131 S. Volltext nicht online. |
| Kuegeler, E. and Weber, A. and Lisiewicz, S. (2001) Combination of a Transition Model with a Two-Equation Turbulence Model and Comparison with Experimental Results. In: Proceedings of the 4th European Conference on Turbomachinery, pp. 877-887. ATI. Proceedings of the 4th European Conference on Turbomachinery, Florenz, Italy, 23.03.2001. ISBN 88-86281-57-9. Volltext nicht online. |
| Kuesters, B. (1996) Numerische Untersuchung zweier KWU-Verdichtergitter mit dem Navier-Stokes-Verfahren TRACE. Vortrag bei Siemens AG/KWU in Muelheim/Ruhr, 02.07.1996. Volltext nicht online. |
| Kuesters, B. (1997) 3D-Auslegung zweier transsonischer Rotoren. 2. Statusgespräch der Kooperation Siemens/DLR, Muelheim, 19.12.97. Volltext nicht online. |
| Kämpf, K.-D. (1993) Numerische Berechnung und Analyse der Stroemung in einem Radialdichterrotor mit axialem Vorsatzlaeufer. Other. Dipl.-Arbeit, Universität Bochum (RUB), April 1993. 129 S. Volltext nicht online. |
| Kärcher, Bernd and Schumann, Ulrich and Brinkop, Sabine and Busen, Reinhold and Fiebig, Markus and Flentje, Harald and Gierens, Klaus and Graf, Jutta and Haag, Werner and Hendricks, Johannes and Mannstein, Hermann and Marquart, Susanne and Meyer, Richard and Minikin, Andreas and Petzold, Andreas and Ponater, Michael and Sausen, Robert and Schmid, Heidi and Wendling, Peter and Aigner, Manfred and Frank, Peter and Geigle, Klaus-Peter and Gerlinger, Peter and Noll, Berthold and Stricker, Winfried and Wahl, Claus and Schurath, U. and Möhler, O. and Schaefers, S. and Stetzer, O. and Schrems, O. and Beyerle, G. and Immler, F. and Kruse, H. and Döpelheuer, Andreas and Plohr, Martin and Schiller, C. and Bläsner, M. and Krämer, M. and Mangold, A. and Wollny, A. and Borrmann, S. and Curtius, J. and Henseler, S. and Hock, N. and Schneider, J. and Weimer, S. and Arnold, F. and Aufmhoff, H. and Gollinger, K. and Kiendler, A. and Stilp, Th. and Wilhelm, S. and Wohlfrom, K.H and Timmreck, C. and Feichter, J. and Lohmann, U. and Ström, J. and Rother, Tom (2004) Particles and Cirrus Clouds (PAZI) - Overview of Results 2000-2003. Project Report. 83. EC. 197 S. Volltext nicht online. |
| Köller, U. (1999) Entwicklung einer fortschrittlichen Profilsystematik für stationäre Gasturbinenverdichter. DLR-Forschungsbericht. 1999-20. Dissertation. 121 S. Volltext nicht online. |
| Köller, U. and Mönig, R. and Küsters, B. and Schreiber, H.-A. (1999) Development of Advanced Compressor Airfoils for Heavy-Duty Gas Turbines. Part I: Design and Optimization. In: ASME Paper 99-GT-95. International Gas Turbine and Aeroengine Congress, Indianapolis, 7.-10. June 1999. Volltext nicht online. |
| Köller, U. and Mönig, R. and Küsters, B. and Schreiber, H.A. (2000) Development of Advanced Compressor Airfoils for Heavy-Duty Gas Turbines - Part I: Design and Optimization. ASME Journal of Turbomachinery, 122 (3), pp. 397-405. Volltext nicht online. |
| Kügeler, E. (2000) Numerische Untersuchung der Filmkühlung aus einer Reihe von Fan-Shaped Bohrungen auf der Saugseite einer Turbinenschaufel und Vergleich mit Experimenten. DGLR Jahrestagung 2000, Leipzig, 21.09.2000. Volltext nicht online. |
| Kügeler, E. (2005) Numerisches Verfahren zur genauen Analyse der Kühleffektivität filmgekühlter Turbinenschaufeln. DLR-Forschungsbericht. 11. Dissertation. 130 S. Volltext nicht online. |
| Kügeler, E. and Nürnberger, D. (2004) TRACE User's Manual - Version 2.2. DLR-Interner Bericht. 325-07-04. 78 S. Volltext nicht online. |
| Kühner, C. (1997) Entwurf von rotierenden Kühlkanälen in Gasturbinenschaufeln auf Basis numerischer Analyse der Strömung und Druckverluste. DLR-Interner Bericht. 325-08-97. 108 S. Volltext nicht online. |
| Küsters, B. and Schreiber, H. A. and Steinert, W. (1996) Experimentelle und theoretische Untersuchungen des Verdichtergitters KWU-HPA 28/08. DLR-Interner Bericht. 325-06-96. 199 S. Volltext nicht online. |
| Küsters, B. and Schreiber, H.-A. (1998) Compressor Cascade flow with Strong Shock/Wave/Boundary-Layer Interaction. AIAA Journal, 36 (11), pp. 2072-2078. Volltext nicht online. |
| Küsters, B. and Schreiber, H.-A. and Köller, U. and Mönig, R. (1999) Development of Advanced Compressor Airfoils for Heavy-Duty Gas Turbines. Part II: Experimental and Theoretical Analysis. In: ASME Paper 99-GT-96. International Gas Turbine and Aeroengine Congress, Indianapolis, 7.-10. June 1999. Volltext nicht online. |
| Küsters, B. and Schreiber, H.-A. and Steinert, W. (1998) Experimentelle und numerische Untersuchung des Gasturbinen-Verdichtergitters KWU-HPA-26/070. DLR-Interner Bericht. 325-06-98. Volltext nicht online. |
| Küsters, B. and Schreiber, H.A. and Köller, U. and Mönig, R. (2000) Development of Advanced Compressor Airfoils for Heavy-Duty Gas Turbines - Part II: Experimental and Theoretical Analysis. ASME Journal of Turbomachinery, 122 (3), pp. 406-414. Volltext nicht online. |
| Küsters, B. and Steinert, W. and Schreiber, H. A. (1996) Experimentelle und theoretische Untersuchungen des Verdichtergitters KWU-HPA 17/06. DLR-Interner Bericht. 325-07-96. 203 S. Volltext nicht online. |
| Kügeler, Edmund and Geiser, Georg and Wellner, Jens and Weber, Anton and Moors, Anselm (2018) On the Simulation of unsteady Turbulence and Transition Effects in a Multistage Low Pressure Turbine, Part III: Comparison of Harmonic Balance and Full Wheel Simulation. In: Proceedings of the ASME Turbo Expo. ASME 2018 Turbo Expo, 2018-06-11 - 2018-06-15, Oslo, Norwegen. doi: 10.1115/GT2018-76749. Volltext nicht online. |
| Kühn, Martin Joachim and Holke, Johannes and Lutz, Annette and Thies, Jonas and Röhrig-Zöllner, Melven and Bleh, Alexander and Backhaus, Jan and Basermann, Achim (2023) SIMD vectorization for simultaneous solution of locally varying linear systems with multiple right hand sides. Journal of Supercomputing. Springer Nature. doi: 10.1007/s11227-023-05220-4. ISSN 0920-8542. |
| Langer, R. (1993) Auslegung eines ebenen transsonischen Verdichterschnittes mit hoher Umlenkung. DLR-Interner Bericht. 325-03-93. DLR, SM-AT. 96 S. Volltext nicht online. |
| Langowsky, C. (1992) AG-Turbo Halbjahresberichte II/1992-Teilverbundprojekt Turbotech. Project Report, DLR-Interner Bericht. 6 S. Volltext nicht online. |
| Langowsky, C. (1996) The Influence of Film Cooling on the Secondary Flow in a Turbine Nozzle. Fachvortrag ABB-Baden, SChweiz, 29.11.1996. Volltext nicht online. |
| Langowsky, C. (1996) The Interaction between Secondary Flow and Film Cooling in a Turbine Nozzle. ICAS paper 96-6.10.1, Sorrento, Italien, 9.-12.9.1996. Volltext nicht online. |
| Langowsky, C. (1996) Test Case 'Subsonic Low Aspect Ratio Turbine Nozzle'. AGARD Working Group 26. Volltext nicht online. |
| Langowsky, C. (1996) Aerodynamic Losses in a Film Cooled Turbine Nozzle with Varied Blowing Ratios-An Experimental Investigation. Proceedings ISAIF, Peking, China, 1.-6.9.1996. Volltext nicht online. |
| Langowsky, C. (1997) Wechselwirkung von Sekundaerstroemung und Kuehlluft in filmgekuehlten Turbinenstatoren. DLR-Forschungsbericht. 97-50. Dissertation. 115 S. Volltext nicht online. |
| Langowsky, C. (1997) Experimentelle Analyse der Sekundaerstroemung in Turbinen mit Kuehlluftausblasung. Project Report, DLR-Interner Bericht. Abschlußbericht AG Turbo, Turbotech I, Vorhaben 1.2.2.4. 120 S. Volltext nicht online. |
| Langowsky, C. and Vogel, D. T. (1995) The Influence of Film Cooling on the Secondary Flow in a Turbine Stator - An Experimental and Numerical Investigation -. In: AIAA paper 95-3040,San Diego, CA, USA. c by American Inst. of Aeronautics and Astronautics, Washington D.C. Volltext nicht online. |
| Langowsky, C. and Vogel, D.T. (1996) Influence of Film Cooling on the Secondary Flow in a Turbine Nozzle. A publication of the AIAA, Inc., 1801 Alexander Bell Drive, Suite 500. AIAA Journal, Volume 35, NUMBER 1. Volltext nicht online. |
| Langowsky, C. and Vogel, D.T. (1996) Influence of Film Cooling on the Secondary Flow in a Turbine Nozzle. AIAA Journal, 35, pp. 111-118. Volltext nicht online. |
| Langowsky, C. and Voigt, P. (1994) Film Cooling of an Annular Turbine Stator - Visualisation of Ccoling Air Ejection and its Effects on the Aerodynamic Losses. 12th Symposium on Measuring Techniques for Transonic and Supersonic Flow in Cascade and Turbomachines, Prague, Sept. 1994, Czech. Rep.. Volltext nicht online. |
| Lauer, G. and Habisreuther, P. and Leuckel, W. and Eickhoff, H. (1996) Experimentelle Überprüfung eines JPDF-Reaktionsmodells. Gaswärme International, 45. Volltext nicht online. |
| Lawrenz, K. (1990) Stroemungssichtbarmachung im rotierenden Kanal. DLR-Interner Bericht. 325-05-90. 109 S. Volltext nicht online. |
| Lawrenz, K. (1991) Strömungsmessung mit Hilfe eines Laser-Anemometers in einem zylindrischen Modellkanal. DLR-Interner Bericht. 325-01-91. 105 S. Volltext nicht online. |
| Lecheler. S., and Schnell, R. and Stubert, B. (2001) Experimental and Numerical Investigation of the Flow in a 5-Stage Transonic Compressor Rig. ASME Turbo-Expo 2001, 4.-7. Juni 2001, New Orleans/U.S.. Volltext nicht online. |
| Lecht, A. and Deidewig, F. and Döpelheuer, A. and Schmitt, A. (1999) Entwicklung und Bewertung vereinfachter Verfahren zur Bestimmung von Abgasemissionen aus Flugtriebwerken im Reiseflug. Project Report. o.A.. DLR. 64 S. Volltext nicht online. |
| Lecht, M. (1998) Kyoto targets and technology aspects. 2nd Meeting of Expert Working Group on the Kyoto Follow Up in Aviation, Brüssel, 26. Jan. 1998, EC, DG VII, Transport. Volltext nicht online. |
| Lecht, M. (1998) Considerations on the enhancement of emission certification from LTO to cruise and from engine to aircraft. ICAO/CAEP/WG3 (Emission Technical) First Meeting, Phoenix, USA, 15-16 December 1998. Volltext nicht online. |
| Lecht, M. (1999) Comparison of DLR Fuel Flow Method and the P3-T3 Method for Cruise EINOX Prediction. ICAO/CAEP/WG3 Alternative Emissions Methodology Task Group, Boeing, Seattle, USA, 22/23 Sept. 1999. Volltext nicht online. |
| Lecht, M. (1999) Comparison of AEDC Altitude Chamber Test Data and NOx Correlation based on Similarity of Engine Operation. ICAO/CAEP/WG3 Alternative Emissions Methodology Task Group, STNA, Toulouse, Frankreich, 27. April 1999. Volltext nicht online. |
| Lecht, M. (2000) Effect of Aircraft Engine Bypass Ratio on NOx and CO2 Emissions. ICAO/CAEP/WG3 Alternative Emissions Methodology Task Group, 5th Meeting, 12-13 June, 2000, Cleveland, USA. Volltext nicht online. |
| Lecht, M. (2001) Aspects of Aircraft Performance and NOx Emissions. ICAO/CAEP/Working Group 3 - Alternate Emissions Methodology Task Group (AEMTG), 6th Meeting, 14-15 February, 2001, Toulouse. Volltext nicht online. |
| Lecht, M. (2000) ICAO/CAEP/Working Group 3 Emissions-Technical Issues - Bericht aus den Arbeitsgruppen. Vortrag im Bundesministerium für Verkehr, Bauen- und Wohnungswesen, Bonn, 8.12.2000. Volltext nicht online. |
| Lecht, M. (1990) Thermodynamic Considerations on Fan Engine Recuperative Heat Cycles. In: Proceedings; DGLR-Bericht 90-01 (1990).. European Propulsion Forum "Future Civil Engines and the Protection of the Atmosphere", 3-5 April 1990, Koeln-Porz.. Volltext nicht online. |
| Lecht, M. (1991) Potential of ultra high bypass fan engine heat cycle on the reduction of fuel consumption and NOx-Emission. In: Proceedings of the 10th ISABE. AIAA, 10th ISABE, Sept. 1991, Nottingham (UK), 01.-06.09.1991. Volltext nicht online. |
| Lecht, M. (1994) Emissionen aus Flugtriebwerken - Auswirkungen und Reduzierungspotentiale -. Seminar der Bundesvereinigung gegen Fluglärm e.V., 12.03.93, Hannover. Volltext nicht online. |
| Lecht, M. (1993) Effect of Inlet Pressure and Temperature i.e. Flight Conditions on Emissions. ICAO/CAEP/Working Group 3, Certification/Technology Subgroup 23.-26.02.93, Amsterdam. Volltext nicht online. |
| Lecht, M. (1994) Considerations on Engine NOx-Emission Regulatory Values. ICAO/CAEP/WG 3, Certification/Technology Subgroup, 19.-22.10.93, Paris, France.. Volltext nicht online. |
| Lecht, M. (1994) Schadstoffe des Luftverkehrs. DLR-Jahreshauptversammlung, Messe Köln, 19.11.93. Volltext nicht online. |
| Lecht, M. (1994) Aircraft Emission - Flight Performance and Emission Correlation. ECAC/ANCAT, Emissions Inventory Database Group, 10. Feb. 1994, Dept. of Trade and Industry, London, UK. Volltext nicht online. |
| Lecht, M. (1994) Thematik und Sachstand der Arbeiten in den technischen Arbeitsgruppenfuer Schadstoffemissionen aus dem Luftverkehr der ICAO/CAEP. Vortrag aus Anlass eines Industriegespraeches beim BMV, 30.08.94. Volltext nicht online. |
| Lecht, M. (1996) Engine Modeling and NOx Correlation. Vortrag bei Pratt & Whitney, East Hartford, USA, 12 Sept. 1996. Volltext nicht online. |
| Lecht, M. and Deidewig, F. (1994) Engine Specific NOx Emissions (SFCx El). ICAO/CAEP/WG3 Certification/Technology Subgroup 8.-11. March 1994, Seattle, USA. Volltext nicht online. |
| Lecht, M. and Deidewig, F. (1994) NOx Emission Correlation for Varying Engine Inlet Conditions. ICAO/CAEP/WG3 Certification/Technology Subgroup 8.-11. March 1994, Seattle, USA. Volltext nicht online. |
| Lecht, M. and Deidewig, F. (1994) Small Aeroengine Performance and Emission Correlation. Project Report, DLR-Interner Bericht. 36 S. Volltext nicht online. |
| Lecht, M. and Deidewig, F. and Dameris, M. and Schmitt, A. (1995) Bewertung der globalen Emissionen des zivilen Luftverkehrs als Grundlage für die Anwendung in Atmosphärenmodellen. Project Report, DLR-Interner Bericht. 87 S. Volltext nicht online. |
| Lecht, M. and Deidewig, F. and Döpelheuer, A. (1997) Aircraft Specific Exhaust Emissions. In: Pollutants from Air Traffic: Results of Atmospheric Research 1992-1997, pp. 27-35. Pollutants from Air Traffic: Results of Atmospheric Research 1992-1997. Volltext nicht online. |
| Lecht, M. and Deidewig, F. and Döpelheuer, A. (1998) Flugzeugspezifische Emissionen in "Schadstoffe in der Luftfahrt". In: Schadstoffe in der Luftfahrt. Abschlußkolloquium des BMBF Verbundprogramms, Köln 31.03.1998. Volltext nicht online. |
| Lecht, M. and Deidewig, F., Doepelheuer, A., and Schmitt, A. (FF-VL) (1997) Entwicklung und Bewertung vereinfachter Verfahren zur Bestimmung von Abgasemissionen aus Flugtriebwerken im Reiseflug. Project Report, DLR-Interner Bericht. 43 S. Volltext nicht online. |
| Lecht, M. and Döpelheuer, A. and Plohr, M. (2000) Entwicklung vereinfachter Methoden zur Abgaszertifizierung (NOx) von Triebwerken unter Flugbedingungen. Project Report, DLR-Interner Bericht. Zwischenbericht BMVBW L1/99-50158/98. 48 S. Volltext nicht online. |
| Lecht, M. and Raede, M. and Schmitt, A. (1995) Emissionssituation im Luftverkehr. Seminar im Haus der Technik e.V., Essen am 28.11.1995. Volltext nicht online. |
| Lecht, M. and Schmitt, A. (FF-VL) (1996) Die zeitliche Entwicklung der Verteilung der Luftverkehrsemissionen. Project Report, DLR-Interner Bericht. Zwischenbericht zum BMBF-Forschungsvorhaben Förderkennzeichen 01LL9502/0. 28 S. Volltext nicht online. |
| Lecht, M. and Weyer, H.B. and Wurzel, D. (1994) Pollutants from Air Traffic, Effects and Prevention-A Cooperative Endeaver of Research Centers, Academia and Industry. In: Impact of Emissions from Aircraft and Spacecraft Upon the the Atmosphere. DLR. Impact of Emissions from Aircraft and Spacecraft Upon the the Atmosphere; Proc. of an Int. Sc. Colloquium,Koeln,18-20.4.94. Volltext nicht online. |
| Lee, D.S. and Brunner. B., and Doepelheuer, A. and Falk, R.S. and Gardner, R.M. and Lecht, M. and Leech, M. and Lister, D.H. and Newton, P. (2002) Aviation emissions: present-day and future. Meteorologische Zeitschrift, 11 (3), pp. 141-150. Volltext nicht online. |
| Lehmann, B. (1997) Messungen im drallbehafteten isothermen Strömungsfeld hinter Zweistrom-Zerstäubungsdüsen mit Hilfe dreikomponentiger Transitionsvorgänge. Seminar für Strömungsmechanik, Hermann-Föttinger-Institut für Strömungsmechanik, TU Berlin, 30.5.1997. Volltext nicht online. |
| Lehmann, B. and Barsikow, B. (1) (1996) Lichtschnittuntersuchungen der Instabilitaetsformen eines heissen Luft-Freistrahls. In: Proceedings 5. Fachtagung der GALA e.V. "Lasermethoden in der Strömungsmeßtechnik (1996). 5. Fachtagung der GALA e.V. "Lasermethoden in der Strömungsmeßtechnik ", 11.-13.9.1996. Volltext nicht online. |
| Lehmann, B. and Graichen, K. and Ruck, B. and Leder, A. and Dopheide, D. (1996) Lasermethoden in der Stroemungsmesstechnik. 5. Fachtagung der GALA e.V. In: Tagungsband der 5. GALA-Fachtagung, 11.-13. September 1996, TU Berlin.. Shaker-Verlag, Aachen 1996.. Volltext nicht online. |
| Lehmann, B. and Hassa, C. and Helbig, J. (1996) Three-Component Laser-Doppler Measurements of the Confined Model Flow Behind a Swirl Nozzle. In: Proceedings 8th International Symposium on Applications of Laser Techniques to Fluid Mechanics (1996). 8th Int. Symp. on Applic. of Laser Techniques to Fluid Mechanics, 8-11 July 1996 Lissabon. Volltext nicht online. |
| Lehmann, B. and Hassa, C. and Helbig, J. (1997) Three-component Laser-Doppler measurements of the confined model flow behind a swirl model. In: Development in Laser Techniques and Fluid Mechanics: Selected Papers from the 8th International Symposium , Lisbon, Portugal, 8-11 July 1996 (Hrsg.: R.J. Adrian, D.F.G. Durao, F. Durst, M.V. Heitor, M. Maeda, J.H. Whitelaw). Springer-Verlag, Berlin 1997. Volltext nicht online. |
| Lehmann, B. and Mante, J. (1995) Schnelles Scannen eines Strömungsfeldes mit einer Laser-Doppler-Meßtechnik. DGLR-Fachausschußsitzung "Flächige Strömungsmeßverfahren", Berlin, 2.-3. März 1995. Volltext nicht online. |
| Lehmann, B. and Mante, J. (1996) Eigenschaften, Probleme und Entwicklungspotential der Laser-Doppler-Scanning-Methode zur schnellen Erfassung von Geschwindigkeitsprofilen. In: Proceedings LIF 8 (1996) 8 S., 10 Bild., 3 Lit.. LIF 8, Köln, 18.-19. 6. 1996. Volltext nicht online. |
| Lehmann, B. and Mante, J. and Helbig, J. (1996) Dreikomponenten-LDA-Messungen in einer vorgemischten Stauflamme. In: Proceedings 5. Fachtagung der GALA e.V. "Lasermethoden in der Strömungsmeßtechnik" (1996). 5. Fachtagung der GALA e.V., TU Berlin, 11.-13.9.1996. Volltext nicht online. |
| Leicht, Tobias and Bleh, Alexander and Braun, Sebastian and Einarsson, Gunnar and Flamarique Ederra, Imanol and Hartmann, Ralf and Holke, Johannes and Jägersküpper, Jens and Klitz, Margrit and Orlt, Matthias and Rempke, Arne and Rüttgers, Alexander and Schwöppe, Axel and Spiering, Frank and Vollmer, Daniel (2018) Towards a Unified Platform for Massively Parallel Numerical Flow Simulation. Deutscher Luft- und Raumfahrtkongress 2018, 2018-09-04 - 2018-09-06, Friedrichshafen. (Unpublished) Volltext nicht online. |
| Lempereur, Christine and Barricau, Philippe and Gleyzes, Christian and Willert, Christian and Stockhausen, Guido and Klinner, Joachim (2006) Mise en oeuvre et validation de la velocimetrie Doppler globale en soufflerie. Congrès Francophone de Techniques Laser (CFTL 2006), 2006-09-19 - 2006-09-22, Toulouse (France). Volltext nicht online. |
| Lempereur, Christine and Barricau, Philippe and Gleyzes, Christian and Willert, Christian and Stockhausen, Guido and Klinner, Joachim (2006) Doppler global velocimetry in wind tunnels - implementation issues and performance analysis. 13th International Symposium on Applications of Laser Techniques to Fluid Mechanics, 2006-06-26 - 2006-06-29, Lissabon (Portugal). Volltext nicht frei. |
| Lengyel-Kampmann, Timea and Karboujian, Jirair and Charroin, Guillaume and Winkelmann, Peter (2024) Experimental Investigation of an Efficient and Lightweight Designed Counter-Rotating Shrouded Fan Stage. International Journal of Turbomachinery, Propulsion and Power, 9 (3). Multidisciplinary Digital Publishing Institute (MDPI). doi: 10.3390/ijtpp9030026. ISSN 2504-186X. |
| Lengyel-Kampmann, Timea and Voß, Christian and Nicke, Eberhard and Rüd, Klaus-Peter and Schaber, Reinhold (2014) Generalized optimization of counter-rotating and single-rotating fans. ASME2014, 2014-06-16 - 2014-06-20, Düsseldorf, Germany. doi: 10.1115/GT2014-26008. Volltext nicht online. |
| Lenze, M. (1994) Experimentelle Untersuchungen zum Fett-Mager-Verbrennungskonzept bei triebwerksspezifischen Randbedingungen. Other. 74 S. Volltext nicht online. |
| Leyh, Sascha and Morsbach, Christian (2019) The coupling of a synthetic turbulence generator with turbomachinery boundary conditions. ERCOFTAC Workshop Direct and Large Eddy Simulation 12, 2019-06-05 - 2019-06-07, Madrid, Spanien. Volltext nicht online. |
| Liersch, Carsten M. and Cummings, Russel M. and Schütte, Andreas (2021) Multi-Disciplinary Design and Performance Assessment of Effective, Agile NATO Air Vehicles. [Other] Volltext nicht online. |
| Lindblad, Daniel and Frey, Christian and Junge, Laura and Ashcroft, Graham and Andersson, Niklas (2022) Minimizing Aliasing in Multiple Frequency Harmonic Balance Computations. Journal of Scientific Computing, 91 (2). Springer. doi: 10.1007/s10915-022-01776-0. ISSN 0885-7474. |
| Linke, Florian and Dahlmann, Katrin and Gerlinger, Berit and Wöhler, Sebastian and Otten, Tom and Plohr, Martin and Presto, Felix and Hartmann, Johannes and Weiss, Marco (2020) The impact of a new mid-range aircraft with advanced technologies on air traffic emissions and climate. In: AIAA Aviation 2020 Forum. 2020 AIAA AVIATION Forum Virtual Event, 2020-06-15 - 2020-06-19, online. doi: 10.2514/6.2020-2650. ISBN 978-162410598-2. Volltext nicht frei. |
| Linke, Florian and Ehlers, Thorsten and Lütjens, Klaus and Lau, Alexander and Weder, Christian Martin and Buchtal, Kuno Arthur and Kühlen, Markus and Jurkat-Witschas, Tina and Dahlmann, Katrin and Voigt, Christiane and Grewe, Volker and Leipold, Alexandra and Ratei, Patrick and Zill, Thomas and Berghof, Ralf and Gelhausen, Marc (2023) Potenzial zur Treibhausgas-Emissionsminderung im Luftverkehr bis 2030. DLR-Interner Bericht. DLR-IB-LV-HA-2023-118. 85 S. Volltext nicht frei. |
| Lisiewicz, S. (1996) Numerical Analysis of the DLR Turbine Stator VT1B. AGARD WG 26, Meeting in Athen, 1996. Volltext nicht online. |
| Liu, J. M. (1) and Holste, F. and Neise, W. (1996) On the azimuthal mode structure of rotating blade flow instabilities in axial turbomachines. In: Proc. 2nd AIAA/CEAS Aeroacoustics Conference (1996). 2nd AIAA/CEAS Aeroacoustics Conference (17th AIAA Aeroacoustics Conference), May 6-8, 1996, Penn State University, State College, Penns., USA. Volltext nicht online. |
| Lynn, T. B. and Bechert, D. W. and Gerich, D. A. (1995) Direct Drag Measurements in a Turbulent Flat Plate Boundary Layer with Turbulence Manipulators. Experiments in Fluids, Vol. 19, pp. 404-415. Volltext nicht online. |
| Lüken, Julian and Schöffler, Robin (2023) CoolingGen - A parametric 3D-modeling software for turbine blade cooling geometries using NURBS. DLR-Interner Bericht. DLR-IB-AT-GO-2023-5. Master's. Georg-August-Universität Göttingen. Volltext nicht frei. |
| Maass, M. (1995) Druckmessungen mit Halbleiter-Miniatursonden. Volltext nicht online. |
| Maass, M. (1995) Kalibrierung von Halbleiter-Drucksonden. DLR-Mitteilung. 95-03. Volltext nicht online. |
| Maass, M. (1995) Laser Measurements in Ducted Propfan Blade Wakes. 31st AIAA/ASME/SAE/ASEE Joint Propulsion Conference, July, 10-12, 1995, San Diego, CA, USA. Volltext nicht online. |
| Maass, Martin (1993) Temperature Error Compensation of a Miniature Semiconductor Pressure Transducer and First Results of Measurements Taken in a Ducted Propfan Rotor. Measuring Techniques for Transsonic and Supersonic Flow in Cascades a nd Turbomaschines/Proceed. of the 11th Sympos. 14.-15.09.92, Muenchen. Volltext nicht online. |
| Maass, M., Foerster, W., and Thiele, P. (1994) Unsteady Flow Experiments in the Exit of a Ducted Propfan Rotor. In: 30th AIAA/ASME/SAE/ASEE Joint Propulsion Conference, 27.-29. June 199 4, Indianapolis, USA.. Volltext nicht online. |
| Maaß, M. (1996) Analyse der räumlichen Strömung im Austritt eines Propfans. DLR-Forschungsbericht. 96-07. Dissertation. 119 S. Volltext nicht online. |
| Magens, E. (1992) Entwicklung eines eigenen Rechenverfahrens zur Simulation von H2O-CARS Spektren bei hohen Temperaturen. LIF 5, 1992-01-27 - 1992-01-28, Lampoldhausen . Volltext nicht online. |
| Magens, E. (1992) Simulation of H2O-Spectre. Meeting HERMES diagnostic group, 1992-02-24, Köln-Porz. Volltext nicht online. |
| Magens, E. and Leipertz, A. (1992) Evaluation of accumulated rotational CARS spectre taken in mixing regions of flames. XI'th CARS-Workshop, 1992-02-23 - 1992-02-25, Florenz, Italy. Volltext nicht online. |
| Marnett, M. (2004) Numerische Simulation der Kühlluftströmung in einem verrippten Multipass-Kühlsystem einer Turbinenschaufel. DLR-Interner Bericht. 325-14-04. 113 S. Volltext nicht online. |
| Martin, B. (2004) Experimentelle Studien zur wandnahen, kompressiblen Strömung in Verdichtergittern. DLR-Interner Bericht. DLR-IB 325 - 10 - 04. Diploma. 157 S. Volltext nicht online. |
| Martin, Seifert and Guido, Stockhausen and Richard, Schodl and Willert, Christian (2007) Untersuchung möglicher Fehlerquellen bei der Konzentrationsmessung mittels des Quantitativen Lichtschnittverfahrens (QLS). DLR-Interner Bericht. DLR-IB 325-20-07. 18 S. Volltext nicht online. |
| Matha, Marcel and Kucharczyk, Karsten (2022) Applicability of machine learning in uncertainty quantification of turbulence models. Other. Institut für Antriebstechnik. 17 S. |
| Matha, Marcel and Kucharczyk, Karsten and Morsbach, Christian (2022) Assessment of data-driven Reynolds stress tensor perturbations for uncertainty quantification of RANS turbulence models. In: AIAA Aviation 2022 Forum. AIAA AVIATION Forum 2022, 2022-06-27 - 2022-07-01, Chicago, Illinois, USA. doi: 10.2514/6.2022-3767. ISBN 978-1-62410-635-4. |
| Matha, Marcel and Morsbach, Christian and Bergmann, Michael (2018) A comparison of methods for introducing synthetic turbulence. In: 6th ECCOMAS European Conference on Computational Mechanics: Solids, Structures and Coupled Problems, ECCM 2018 and 7th ECCOMAS European Conference on Computational Fluid Dynamics, ECFD 2018, pp. 278-289. 7th ECCOMAS European Conference on Computational Fluid Dynamics, 2018-06-11 - 2018-06-15, Glasgow. ISBN 978-849473116-7. |
| Matthiä, Daniel and Schaefer, Martin and Meier, Matthias M. (2015) Economic impact and effectiveness of radiation protection measures in aviation during a ground level enhancement. Journal of Space Weather and Space Climate, 5, A17. EDP Sciences. doi: 10.1051/swsc/2015014. ISSN 2115-7251. |
| Meier, U.E. and Stricker, W. and Wolff-Gassmann, D. and Heinze, J. (2002) Planare Temperaturmessung am OH mittels LIF in technischen Verbrennungssystemen. Gaswärme international, 51 (4), pp. 178-183. Volltext nicht online. |
| Meislitzer, B. and Pommerening, S. and Stursberg, K. (1994) Korrekturerfordernisse bei Thermoelementenmessungen in Flammen. DLR-Interner Bericht. 325-14-94. 122 S. Volltext nicht online. |
| Melake, A. (1991) Isoparametric Finite Element Approach to Particle Trajectory: Applied as an Analysis Tool to CRISP Aerodynamics. DLR-Forschungsbericht. 91-40. 89 S. Volltext nicht online. |
| Melake, A. (1996) Numerische Simulation der Strömung im radialen Schaufelspalt axialer Turbomaschinen. DLR-Forschungsbericht. 96-06. Dissertation. 125 S. Volltext nicht online. |
| Melake, A. (1996) Differentialtopologische Analyse der singulaeren Punkte in der Stroemungsmechanik. DLR-Interner Bericht. 325-01-96. Volltext nicht online. |
| Melake, A. (1997) Three-dimensional Navier-Stokes Analysis of Tip Clearance Flow in an Annular Compressor Cascade. 33rd AIAA/ASME/SAE/ASEE Joint Propulsion Conference & Exhibit, 6-9 July, 1997, Seattle, USA. Volltext nicht online. |
| Mennicken, Maximilian and Hollmann, Carsten and Staggat, Martin and Schnell, Rainer and Silberhorn, Daniel and Arzberger, Max Josef and Eichner, Franziska and Winkelmann, Peter (2020) Preliminary Fan Design for a Full Annulus BLI Propulsor. Deutscher Luft- und Raumfahrtkongress 2020, 2020-09-01 - 2020-09-03, Aachen, Germany. Volltext nicht online. |
| Mennicken, Maximilian and Schönweitz, Dirk and Schnös, Markus and Schnell, Rainer (2019) Fan Design Assessment for BLI Propulsion Systems. Deutsche Gesellschaft für Luft- und Raumfahrt - Lilienthal-Oberth e.V.. Deutscher Luft- und Raumfahrtkongress 2019, 2019-09-30 - 2019-10-02, Darmstadt, Germany. Volltext nicht online. |
| Mennicken, Maximilian and Schönweitz, Dirk and Schnös, Markus and Schnell, Rainer (2021) Fan design assessment for BLI propulsion systems. CEAS Aeronautical Journal, Vol.12 (4). Springer. doi: 10.1007/s13272-021-00532-8. ISSN 1869-5582. |
| Mercier, T. (2003) Calibration of a Hot Wire Probe and turbulence measurements. DLR-Interner Bericht. 225-2003 A 01. 35 S. Volltext nicht online. |
| Merenda, T. and Röber, T. (2004) Berücksichtigung von Wandrauhigkeit in einem RANS-basierten CFD-Verfahren für Turbomaschinenströmungen. DLR-Interner Bericht. 325-12-04. Diploma. 52 S. Volltext nicht online. |
| Metzinger, H. (1991) Untersuchung zur Eigenerwärmung von NTC-Thermistoren. DLR-Interner Bericht. 325-09-91. 23 S. Volltext nicht online. |
| Meyer, R. and Bechert, D. W. and Hage, W. (1996) Separation control on a glider wing with artificial bird feathers. In: Proceedings Advances in Turbulence VI, pp. 471-472. Kluwer, Dordrecht. 6th European Turbulence Conference, Lausanne, 2-5 July 1996. Volltext nicht online. |
| Meyer, R. and Bechert, D. W. and Hage, W. (1996) Artificial birds feathers as a lift-enhancing device on airfoils. XIXth International Congress of Theoretical and Applied Mechanics, Kyoto, Japan, 25-31 August 1996. Volltext nicht online. |
| Meyer, R. and Bechert, D. W. and Hage, W. and Patone, G. (1995) Rückstrombremse nach dem Vorbild der Vogel-Deckfedern. Seminar "Bionik, Evolutionsstrategie, neuronale Netze, TU Berlin, 1. Dezember 1995. Volltext nicht online. |
| Meyer, R. and Bechert, D.W. and Hage, W. (1997) Experiments with the artificial bird feathers for separation control on airfoils. Euromech Colloquium 361, "Active Control of Turbulent Shear Flows" and Final Colloquium of DFG Research Group Control of Turbulent Shear Flows, März 1997, TU Berlin. Volltext nicht online. |
| Meyer, R. and Bechert, D.W. and Hage, W. (1997) Wind tunnel and flight experiments with artificial bird feathers for separation control on airfoils. Euromech 3rd European Fluid Mechanics Conference 1997, September 1997, Göttingen. Volltext nicht online. |
| Meyer, R. and Bechert, D.W. and Hage, W. and Montag, P. (1997) Aeroflexible Oberflächenklappen als "Rückstrombremsen" - nach dem Vorbild der Deckfedern des Vogelflügels. DLR-Interner Bericht. 92517-97/B5. 55 S. Volltext nicht online. |
| Meyer, R. and Bechert, D.W. and Hage, W. and Montag, P. (1997) Aeroflexible Oberflächenklappen als Rückstrombremsen (nach dem Vorbild der Vogeldeckfedern). Symposium für Segelflugzeugentwicklung, Stuttgart, 11.12.11.97. Volltext nicht online. |
| Michel, U. (1995) Broadband Shock Noise: Theory vis-a-vis Experimental Results. In: Proc. First CEAS/AIAA Aeroacoustics Conference. DGLR-Bericht 95-01 (1995), pp. 545-554. First CEAS/AIAA Aeroacoustics Conference (16th AIEAA Aeroacoust. Conference), Munich, 12-15 June 1995. Volltext nicht online. |
| Michel, U. (1995) Aerodynamic Sound Generation of Wind Turbines. In: Proceedings ERCOFTAC-Workshop (1995), pp. 26-33. ERCOFTAC-Workshop, Dresden, 28-29 September 1995. Volltext nicht online. |
| Michel, U. (1995) Turbulenzmodellierung in Stroemungen mit Verbrennung. ABB-DLR-Workshop, Baden/Schweiz, 20.10.1995. Volltext nicht online. |
| Michel, U. (1995) Turbulence in Windtunnels. Seminar, Tel Aviv University, Israel, 9 May 1995. Volltext nicht online. |
| Michel, U. (1995) Sound Generation by Aircraft. DLR-Interner Bericht. 92517-95/B5. 89 S. Volltext nicht online. |
| Michel, U. (1997) Feasibility study on the use of two-dimensional microphone arrays in the DNW. DLR-Interner Bericht. 92517-97/B2. 41 S. Volltext nicht online. |
| Michel, U. (1997) Investigation of moving sound sources with planar microphone arrays. DLR-Interner Bericht. 92517-97/B3. 12 S. Volltext nicht online. |
| Michel, U. (1997) Investigation on noise sources in high.speed flight with a microphone array. Beijing University of Aeronautics and Astronautics, Beijing, VR China, 21.10.97. Volltext nicht online. |
| Michel, U. (1997) The theory of flight effects on jet mixing noise and broadband shock noise. Beijing University of Aeronautics and Astronautics, Beijing, VR China, 24.10.97 / Northwestern Polytechnical University, Xi'an, Shaanxi, VR China, 28.10.97. Volltext nicht online. |
| Michel, U. and Barsikow, B. and Haverich, B. and Schüttpelz, M. (1997) Investigation of airframe and jet noise in high-speed flight with a microphone array. 3rd AIAA/CEAS Aeroacoustics Conference, May 1997, Atlanta, Georgia, USA; Paper No. 97-1596. Volltext nicht online. |
| Migueis, C. (1994) Experimentelle und numerische Untersuchung zur Optimierung des Mischmoduls einer fett-mager-gestuften Brennkammer. Vortrag im Institut fuer Antriebstechnik, DLR, Koeln-Porz, 12.09.94. Volltext nicht online. |
| Migueis, C.E. (1995) Experimentelle und numerische Untersuchung zur Optimierung des Mischmoduls einer fett-mager-gestuften Brennkammer. MTU München, 04.04.1995, München. Volltext nicht online. |
| Migueis, C.E. (1996) Untersuchungen zur Optimierung der Mischzone einer fett-mager gestuften Ringbrennkammer. Kolloquium Energietechnik, Ruhr-Universitaet Bochum, 14.02.1996. Volltext nicht online. |
| Migueis, C.E. (1996) Untersuchungen zur Optimierung der Mischzone einer fett-mager gestuften Ringbrennkammer. DLR-Forschungsbericht. 96-33. Dissertation. 99 S. Volltext nicht online. |
| Migueis, C.E. and Hassa, C. (1995) Experimentelle und numerische Untersuchung zur Optimierung des Mischmoduls einer fett-mager gestuften Brennkammer. 17. Deutscher Flammentag, 12./13. Sept. 1995, TU Hamburg-Harburg. Volltext nicht online. |
| Moreau, Antoine and Le Denmat, Anne-Laure and Guerin, Sebastien (2011) Design of the new NWB Ventilator : an Acoustic and Aerodynamic Study. DLR-Interner Bericht, Project Report. DLR-IB 92517-11/B6. 88 S. Volltext nicht online. |
| Moreau, Antoine and Prescher, Andrej and Schade, Stephen and Dang, Maikhanh and Jaron, Robert and Guerin, Sebastien (2023) A framework to simulate and to auralize the sound emitted by aircraft engines. In: INTER-NOISE and NOISE-CON Congress and Conference Proceedings. Inter-Noise 2023, 2023-08-20 - 2023-08-23, Chiba, Japan. doi: 10.3397/IN_2023_1073. Volltext nicht online. |
| Moreau, Antoine and Schnell, Rainer and Mennicken, Maximilian (2022) Acoustic preliminary design of a low-noise fan stage considering a variable-area nozzle and variable-pitch rotor blades. DLRK 2022, 2022-09-26 - 2022-09-29, Dresden. Volltext nicht online. |
| Moreau, Antoine and Schnell, Rainer and Mennicken, Maximilian (2023) Acoustic preliminary design of a low-noise fan stage considering a variable-area nozzle and variable-pitch rotor blades. CEAS Aeronautical Journal, 14 (2), pp. 325-341. Springer. doi: 10.1007/s13272-023-00658-x. ISSN 1869-5590. Volltext nicht online. |
| Moreau, Antoine and Staggat, Martin and Gscheidle, Christian (2019) A fast prediction method for rotor buzz-saw noise based on an analytical approach. In: 25th AIAA/CEAS Aeroacoustics Conference, 2019. 25th AIAA/CEAS Aeroacoustics Conference, paper number: AIAA-2019-2641, 2019-05-20 - 2019-05-23, Delft, The Netherlands. doi: 10.2514/6.2019-2641. Volltext nicht online. |
| Morsbach, Christian and Matha, Marcel and Kügeler, Edmund (2021) Analysis of 3D separated flows in generic diffuser and multi-stage compressor configurations using differential Reynolds stress models. Workshop DFG PAK 948: Near-Wall Flow in Turbomachinery Blade Rows, 2021-01-28, Virtuell. Volltext nicht online. |
| Morsbach, Christian and Schlüß, Daniel and Franke, Martin and Doll, Ulrich and Burow, Eike and Beversdorff, Manfred and Stockhausen, Guido and Willert, Christian (2015) The flow field inside a Ranque-Hilsch vortex tube part II: Turbulence modelling and numerical simulation. Ninth International Symposium on Turbulence Shear Flow Phenomena (TSFP-9), 2015-06-30 - 2015-07-03, Melbourne, Australien. Volltext nicht online. |
| Muehleck, P. (1994) Numerische Loesung der Navier-Stokes Gleichungen in der Lagrange Formulierung zur Berechnung reagierender Stroemungen. Seminarvortrag am Inst. f. Thermo- und Fluiddynamik, Universitaet Bochum, 12.12.1994. Volltext nicht online. |
| Muehleck, P. and Schuetz, H. (1992) Numerische Untersuchungen von Brennkammer-Duesenstroemungen bei Staustrahltriebwerken. In: Proceedings des 8. TECFLAM Seminars: Modellierung technischer Flammen, pp. 53-65. AGARD Paris. 13. November 1992 Darmstadt. Volltext nicht online. |
| Muehleck, P. and Schuetz, H. (1993) 3D-Numerical Simulation of Combustion Chamber and Nozzle Flow Including NOx-Formation. Space Course 1993, TU Muenchen, 11.-22.Okt. 1993. Volltext nicht online. |
| Muehleck, P. and Schuetz, H. (1993) Numerical Study of Nitric Oxide Formation in a Hypersonic Ramjet Engine. In: 11th ISABE, 11.-22.09.93, Tokio, pp. 1275-1283. Volltext nicht online. |
| Muehleck, P. and Stursberg, K. (1993) Fliegen bei Mach 7. DLR-Nachrichten Nr. 73, 1993Der Hyperschallantrieb auf dem Pruefstand, pp. 41-47. Volltext nicht online. |
| Muehleck, R. and Schuetz, H. and Kremer, F. (1991) Influence of the flight trajectory on the exhaust gas composition of a H2-fueled air-breathing ramjet engine. In: Proceedings: Lecture Notes in Engineering. Springer, Heidelberg. 3rd Aerospace Symposium, Braunschweig, 26.-28.08.91. Volltext nicht online. |
| Muller, J.-S. (2001) Kalibration einer Einlochzylindersonde im Unterschallbereich. DLR-Interner Bericht. 225-2001 A 01. Diploma. 40 S. Volltext nicht online. |
| Munoz Lopez, Edwin Joseph and Hergt, Alexander Silvio and Grund, Sebastian (2022) THE NEW CHAPTER OF TRANSONIC COMPRESSOR CASCADE DESIGN AT THE DLR. In: ASME Turbo Expo 2022: Turbomachinery Technical Conference and Exposition, GT 2022, 1, V001T01A005. ASME Turbo Expo Conference, 2022-06-13 - 2022-06-17, Rotterdam, The Netherlands. doi: 10.1115/GT2022-80189. ISBN 978-079188612-0. |
| Munson, Matthew and Willert, Christian and Gharib, Morteza (2009) Real-time PIV for Active Flow Control Applications. 62nd Annual Meeting of the APS Division of Fluid Dynamics, 2009-11-22 - 2009-11-24, Minneapolis, MN, USA. Volltext nicht online. |
| Munzinger, C. (1997) Untersuchung des Emissionsverhaltens von PTL-Triebwerken bei vorgegebener Flugmission. DLR-Interner Bericht. 325-10-97. 114 S. Volltext nicht online. |
| März, J. and Herrmann, M. and Neise, W. (1997) Instrumentierung von Schaufeln des Niedergeschwindigkeitsverdichters der TU Dresden mit Drucksensoren. (Technische Informationen). DLR-Interner Bericht. 92517-97/B8. 53 S. Volltext nicht online. |
| Mönig, Reinhard (2008) Sparsame, leise und emissionsarme Flugzeuge - Wunschtraum oder bald Realität? In: Fünfzehntes Kolloquium Luftverkehr an der Technischen Universität Darmstadt: August-Euler-Luftfahrtpreis Verleihung. Nachhaltiges Wachstum im Luftverkehr - leise, sauber, energieeffizient Kolloquium Luftverkehr, 15. TU Darmstadt. pp. 60-74. ISBN 978-3-931385-17-0. Volltext nicht online. |
| Mönig, Reinhard (2011) Technologien für die Flugantriebe von morgen. 2. Energiesymposium an der Akademie der Wissenschaft und der Literatur Mainz, 2011-02-25, Mainz, Deutschland. (Unpublished) Volltext nicht online. |
| Mönig, Reinhard (2011) Entwicklungstendenzen von Turbokomonenten für Flugantriebe und Gasturbinen der nächsten Generation. Festkolloquium zu Ehren Prof. Dr.ès sc. techn. (EPFL) Horst Stoff, Ruhr-Universität Bochum, 2011-07-11, Bochum, Deutschland. (Unpublished) Volltext nicht online. |
| Mühleck, P. (1995) Numerische Untersuchung turbulenter, reagierender Strömungen in Brennkammern und Schubdüsen von Hyperschall-Staustrahltriebwerken. DLR-Forschungsbericht. 95-18. Dissertation. 127 S. Volltext nicht online. |
| Mühleck, P. and Schütz, H. (1991) Einfluß der Flugbahn auf die Abgaszusammensetzung bei einem Turbo/ Staustrahlantrieb mit Wasserstoff als Brennstoff. DGLR-Fachausschußsitzung "Technologien + Synergien bei Antrieben für 2stufige, horizontalstartende Raumtransporter", Ottobrunn, 21.-22.12.1991. Volltext nicht online. |
| Mühleck, P. and Stursberg, K. (1994) Numerische Simulation turbulenter Verbrennungsvorgaenge und ihre experimentelle Überprüfung an einer Hyperschall-Brennkammer. In: Tagungsband Deutscher Luft- und Raumfahrtkongreß 1994, Jahrbuch der DGLR 1994. Volltext nicht online. |
| Müller, G. (1999) Entwicklung einer lernfähigen Steuerung zur Nachführung einer Gesichtsfeldblende synchron zur Laserablenkung in einem Doppler-Global Velocimeter Messsystem. DLR-Interner Bericht. 325-02-99. 88 S. Volltext nicht online. |
| Mößner, Steffen (2009) Verwendung von Leistungs-Lumineszenzdioden (LED) in der Strömungsmesstechnik. Diploma, Fachhochschule Köln. |
| Müller, Michael and Schöffler, Robin and Grunwitz, Clemens and Morsbach, Christian (2024) Modelling the Film Cooling of a Modern High-Pressure Turbine Nozzle Guide Vane in 3D CFD. In: 69th ASME Turbo Expo 2024: Turbomachinery Technical Conference and Exposition, GT 2024. ASME TurboExpo 2024, 2024-06-24 - 2024-06-28, London, Großbritannien. doi: 10.1115/GT2024-126684. ISBN 978-079188807-0. Volltext nicht online. |
| Nannen, H. (1996) Experimentelle Untersuchungen eines atmosphaerischen Fett-Mager-Brennkammersektors mit zweireihiger Anordnung der Luftstrom-Zerstaeuberduesen. DLR-Interner Bericht. Diplomarbeit Universität Karlsruhe, März 1996. Diploma. 50 S. Volltext nicht online. |
| Neise, W. (1995) Sound Power Measurement Procedures for Fans. Acta Acustica, 3, pp. 473-485. Volltext nicht online. |
| Neise, W. (1995) Akustische Modellgesetze zur Beschreibung und Prognose von Ventilatorgeraeuschpegeln und -spektren basierend auf Modellmessungen. Sitzung FLT-Arbeitsgruppe Ventilatoren des Arbeitskreises 1 Lufttechnik, Braunschweig, 27. Juni 1995. Volltext nicht online. |
| Neise, W. (1995) Entstehungsursachen tieffrequenter Druckschwankungen bei Ventilatoren. Sitzung FLT-Arbeitsgruppe Ventilatoren des Arbeitskreises 1 Lufttechnik, Braunschweig, 27. Juni 1995.. Volltext nicht online. |
| Neise, W. (1995) Research on Propfan Noise and on Rotating Flow Instabilities in Axial Flow Machines. ABB-DLR Workshop, Baden/Schweiz, 20 October 1995. Volltext nicht online. |
| Neise, W. (1995) Tip Clearance Noise and Rotating Instabilities in Axial Flow Machines. ONERA-DLR Workshop at CERT, Toulouse/France, 13 November 1995. Volltext nicht online. |
| Neise, W. (1996) Geraeuschmessverfahren fuer Ventilatoren. In: VDI-Bericht 1249 (1996) 27-41. VDI-GET-Tagung "Ventilatoren im industriellen Einsatz III", Braunschweig, 28.-29.2.1996. Volltext nicht online. |
| Neise, W. (1996) Research at the DLR-Institut für Antriebstechnik, Abteilung Turbulenzforschung Berlin. Spring Workshop Center of Acoustics and Vibration, Penn State University, Pennsylvania, USA. Volltext nicht online. |
| Neise, W. (1997) Lärmminderung an einem Akustik-Windkanal - kleine Ursache, große Wirkung. Seminar für Strömungsmechanik, Herrmann-Föttinger-Institut für Strömungsmechanik, TU Berlin, 31.1.97. Volltext nicht online. |
| Neise, W. (1997) Research at the DLR-Institut fuer Antriebstechnik, Abteilung Turbulenzforschung Berlin (DLR-Institute for Propulsion Technique, Turbulence Research Division Berlin). Beijing University of Aeronautics and Astronautics, Beijing, VR China, 24.10.97 / Northwestern Polytechnical University, Xi'an, Shaanxi, VR China, 27.10.97. Volltext nicht online. |
| Neise, W. (1997) Influence of blade number and tip clearance on tip clearance noise and rotating blade flow instability of axial turbomachines. Beijing University of Aeronautics and Astronautics, Beijing, VR China, 21.10.97 / Northwestern Polytechnical University, XI'an, Shaanxi, VR China, 27.10.97. Volltext nicht online. |
| Neise, W. (1997) Blade tip cavity noise of a large axial-flow wind-tunnel fan. Beijing University of Aeronautics and Astronautics, Beijing, VR China, 24.10.97 / Northwestern Polytechnical University, Xi'an, Shaanxi, VR China, 28.10.97. Volltext nicht online. |
| Neise, W. and Bartenwerfer, M. (1995) Akustische Modellgesetze zur Beschreibung und Prognose von Ventilatorgeraeuschpegeln und -spektren basierend auf Modellmessungen. DLR-Interner Bericht. Forschungsvereinigung für Luft- und Trocknungstechnik e.V., Frankfurt am Main, FLT 3/1/33/95. 69 S. Volltext nicht online. |
| Neise, W. and Dobrzynski, W. and Isermann, U. and König, R. and Claßen, A. B. and Bischoff, G. (2009) Strategien zur Lärmminderung an der Quelle unter Einschluss operationeller Möglichkeiten, speziell für den Nachtflug. DLR-Interner Bericht, Project Report. DLR-IB-92517/B5. Volltext nicht online. |
| Neise, W. and Holste, F. and Miranda, L. and Herrmann, M. (1995) Free-field Sound Power Levels of Open-inlet/Open-outlet Fans and Comparison with In-duct Measurements. Noise Control Engineering Journal, 43, pp. 129-143. Volltext nicht online. |
| Neise, W. and Schulz, J. and Kaplan, B. (2004) Minderung des Triebwerkslärms. Ignition September 2004, Ignition, pp. 46-49. Volltext nicht online. |
| Neise, W. and Wurzel, D. (2007) Weniger Lärm trotz mehr Verkehr. In: Haus der Technik. Tagung Fahrzeugaußengeräusche, 2007-01-30 - 2007-01-31, Essen. Volltext nicht online. |
| Neise, W. and v. Heesen, W. (1) and Lindener, N. (2) and Hansen, J. (1) (1996) Blade tip cavity noise of a large axial-flow wind tunnel fan. In: Proc. 2nd AIAA/CEAS Aeroacoustics Conference (1996). 2nd AIAA/CEAS Aeroacoustics Conference (17th AIAA Aeroacoustics Conference), May 6-8, 1996, Penn State University, State College, Penns., USA. Volltext nicht online. |
| Nicke, E. (1996) Navier-Stokes-Nachrechnung eines transsonischen Fanrotors und Vorstellungen zu neuen Rotorkonzepten. DASA, MTU Muenchen, BRD. Beratung zum Stand der DLR/MTU-Kooperation "Wehrtechnisches Technologieprogramm Niederdruckverdichter", 6.08.1996, MTU, Muenchen. Volltext nicht online. |
| Nicke, E. (1996) Auslegung und Nachrechnung eines Rotors mit "Precompression"-Profilen. DLR, Institut fuer Antriebstechnik, Koeln-Porz, BRD. Statusseminar ueber die MTU/DLR-Kooperation "Gemeinsam zur neuen Triebwerkstechnik", 26.-27.3.96, Koeln-Porz. Volltext nicht online. |
| Nicke, E. (1997) Abschätzung von Kennfeldern für einen transsonischen zweistufigen Axialverdichter mit Theta=4,5. DLR-Interner Bericht. 325-07-97. 35 S. Volltext nicht online. |
| Nicke, E. and Hausmann, J. and Kemme, R. and Kocian, F. (2004) Multidisziplinärer Entwurf höchstbelasteter Verdichterstufen mit neuen Werkstoff- und Konstruktionskonzepten. Deutscher Luft- und Raumfahrtkongress 2004, Dresden, 23.-24.09.2004. Volltext nicht online. |
| Nicke, E. and Hausmann, J. and Kocian, F. and Kemme, R. (2003) Von der Aerodynamik über die Struktur zur Aeroelastik - Integraler Entwurf höchstbelasteter Verdichterstufen. Ehrenkolloquium für Herr Prof. Winterfeld, Köln, Oktober 2003. Volltext nicht online. |
| Nicke, E. and Steinert, W. and Weber, A. and Starken, H. (1993) Design and Analysis of a Highly Loaded Compressor Cascade. 82nd PEP-Sympsosium AGARD, "Technology Requirments for Small Gas Turbines", 4.-8. Oct. 1993, Montreal, Canada. Volltext nicht online. |
| Nicke, Eberhard and Nürnberger, Dirk (2002) Potential of 3D Flow Simulation for Multistage Turbomachinery Design. ODAS Onerea-DLR Aerospace Symposium, 2002-06-13 - 2002-06-14, Köln. Volltext nicht online. |
| Nicklas, M. (2001) Filmgekühlte Turbinenplattform in transsonischem Strömungsfeld. DLR-Forschungsbericht. 2000-10. Dissertation. 177 S. Volltext nicht online. |
| Niklaß, Malte and Dahlmann, Katrin and Plohr, Martin and Grewe, Volker and Gutt, Ekkehard and Katzer, Bernhard and Kluge, Michael and Lau, Alexander and Linke, Florian and Maertens, Sven and Matthes, Sigrun and Scheelhaase, Janina and Thor, Robin Niclas and Wozny, Florian and Zengerling, Zarah Lea (2022) Testing of a Monitoring, Reporting & Verification (MRV) Scheme for the integration of non-CO2 aviation effects into EU ETS. The 5th International Conference on Transport, Atmosphere and Climate (TAC-5), 2022-06-27 - 2022-06-30, Bad Aibling, Deutschland. Volltext nicht frei. |
| Niklaß, Malte and Linke, Florian and Dahlmann, Katrin and Grewe, Volker and Matthes, Sigrun and Plohr, Martin and Maertens, Sven and Wozny, Florian and Scheelhaase, Janina (2022) Decision parameters of an MRV scheme for integrating non-CO2 aviation effects into EU ETS. Project Report. 19 S. |
| Noll, B. and Kessler, R. and Lehmann, B. and Rachner, M. and Frank, P. and Schmitz, G. and Geigle, K.-P. and Meier, W. and Schütz, H. and Forkert, T. and Aigner, M. (2002) Ergebnisse des Projekts "Brennkammermodellierung" (BKM II). DLR-Forschungsbericht, Project Report. 2002-16. 83 S. Volltext nicht online. |
| Nottrott, Sven (2019) Analytische und numerische Untersuchung des Triebwerksschalls bei verteiltem Antrieb unter Berücksichtigung von Grenzschichteinsaugung. Master's, Technische Universität Berlin. Volltext nicht online. |
| Ochrymiuk, T. (2003) Numerical Calculations of the Flow Field within a turbine cascade (Streamline 6). DLR-Interner Bericht. 225-2002 C 06. 34 S. Volltext nicht online. |
| Ochrymiuk, T. (2004) Numerical Investigation of the Flow Field within a Gas Turbine Rotor and Stator Cascade. DLR-Interner Bericht. 225-2004 C 11. 54 S. Volltext nicht online. |
| Ochrymiuk, T. and Gieß, P.-A. and Kost, F. (2004) Experimental Investigations of the Flow Field within a Gas Turbine Rotor Cascade without Coolant Ejektion Designed by RRD. Appendix B. DLR-Interner Bericht. 225 - 2003 C 07 B. 56 S. Volltext nicht online. |
| Ochrymiuk, T. and Gieß, P.-A. and Kost, F. (2004) Experimental Investigations of the Flow Field within a Gas Turbine Rotor Cascade without Coolant Ejection Designed by RRD. DLR-Interner Bericht. 225-2003 C 07. 36 S. Volltext nicht online. |
| Ochrymiuk, T.; Gieß, P.-A.; Kost, F., (2004) Experimental Investigations of the Flow Field within a Gas Turbine Rotor Cascade without Coolant Ejection. Designed by RRD. DLR-Interner Bericht. 225-2003 C 07. 36 S. Volltext nicht online. |
| Oertwig, Sebastian and Siller, Henri and Funke, Stefan (2022) SODIX for fully and partially coherent sound sources. 9th Berlin Beamforming Conference, 2022-06-08 - 2022-06-09, Berlin. |
| Oertwig, Sebastian and Siller, Henri and Schumacher, Timo and Funke, Stefan (2022) Extension of the source localization method SODIX for the determination of partially coherent sound sources. In: 28th AIAA/CEAS Aeroacoustics Conference, 2022. American Institute of Aeronautics and Astronautics. 28th AIAA/CEAS Aeroacoustics 2022 Conference, 2022-06-14 - 2022-06-17, Southampton, UK. doi: 10.2514/6.2022-2812. ISBN 978-162410664-4. Volltext nicht online. |
| Orth, U. and Ebbing, H. and Krain, H. and Weber, A. and Hoffmann, B. (2001) Improved Compressor Exit Diffuser for an Industrial Gas Turbine. In: ASME Turbo Expo 2001, pp. 1-10. ASME, New Orleans, USA, June 2001. Volltext nicht online. |
| Orth, U. and Ebbing, H. and Krain, H. and Weber, A. and Hoffmann, B. (2002) Improved Compressor Exit Diffuser for an Industrial Gas Turbine. Transactions of the ASME, Journal of Turbomachinery (Vol. 124, January 2002), pp. 19-26. Volltext nicht online. |
| Pahlitzsch, Manuel (2018) Entwicklung einer Matrix-Klasse in der Programmiersprache C++ für den Einsatz in ingenieurwissenschaftlichen Problemstellungen. Bachelor's, Duale Hochschule Baden-Württemberg. Volltext nicht online. |
| Pak, H. (1991) Strömungstechnische Untersuchung des Laufrades SRV1 mittels der Ergebnisse numerischer Strömungsrechnungen. FVV-Arbeitskreissitzung, DLR-Köln, 23.10.91. Volltext nicht online. |
| Pak, H. (1991) Überlegungen zur Auslegung des zweiten Laufrades für den Radialverdichterprüfstand der DLR. FVV-Arbeitskreissitzung, DLR-Köln, 22.04.91. Volltext nicht online. |
| Pak, H. (1993) Vergleich von Stroemungsmessungen und Stroemungsrechnungen am SRV1. FVV-Arbeitskreissitzung "Radialverdichter hoher Schluckfaehigkeit", 29.10.1993. Volltext nicht online. |
| Pak, H. (1993) Stand der Lasermessungen am SRV1. FVV-Arbeitskreissitzung "Radialverdichter hoher Schluckfaehigkeit", 12.07.1993, Koeln-Porz. Volltext nicht online. |
| Pak, H. (1993) Zwischenbericht ueber das Vorhaben Nr. 493 "Radialverdichter hoher Schluckfaehigkeit". Forschungsvereinigung Verbrennungskraftmaschinen e.V., Frankfurt a.M.. Informationstagung Turbinen, Fruehjahr 1993. Volltext nicht online. |
| Pak, H. (1994) Stand der Lasermessungen am SRV2 - Erste Ergebnisse. FVV-Arbeitskreissitzung "Radialverdichter hoher Schluckfaehigkeit", 27.10.1994, Oberhausen. Volltext nicht online. |
| Pak, H. (1994) Ergebnisse der Kennfeldmessungen am SRV2. FFV-Arbeitskreissitzung "Radialverdichter hoher Schluckfaehigkeit", 21.04.1994, Koeln-Porz. Volltext nicht online. |
| Pak, H. and Krain, H. (1992) Zischenbericht ueber Vorhaben Nr. 493 Radialverdichter hoher Schluckfaehigkeit. Informationstagung Turbinen des FVV e.V. am k01.04.92 in Lahnstein. Volltext nicht online. |
| Pak, H. and Krain, H. and Hoffmann, B. (1994) Flow Field Analysis in a High Pressure Ratio Centrifugal Compressor. In: AGARD Paper. AGARD Paris. 82nd Symposium, 4.-8. Oct. 93, Montreal, Canada. Volltext nicht online. |
| Pak, H. (1992) Stand der Neuauslegung des Laufrades SRV2. FVV-Arbeitskreissitzung "Radialverdichter hoher Schluckfaehigkeit", 1992-02-05, Oberursel. Volltext nicht online. |
| Pak, H. (1992) Vorstellung eines Geometrieentwurfs fuer das neue Laufrad SRV2. FVV-Arbeitskreissitzung "Radialverdichter hoher Schluckfaehigkeit", 1992-03-18, Koeln-Porz. Volltext nicht online. |
| Pak, H. (1992) Beschreibung des neuen Laufrades SRV2 und vergleichende Untersuchungen der transsonischen Anstroemung fuer den SRV1 und SRV2. FVV-Arbeitskreissitzung "Radialverdichter hoher Schluckfaehigkeit", 1992-09-16, Zürich, Schweiz. Volltext nicht online. |
| Pak, Henry (1993) Stand der Lasermessungen am SRV1. Vortrag: FVV-Arbeitskreissitzung "Radialverdichter hoher Schlucckfaeh igkeit", 17.02.93, Koeln-Porz. Volltext nicht online. |
| Palmberg, Christian (2017) Parametrische Modellierung der Mantelflächen von Propellerblättern zur weiteren Verarbeitung in CAD-Systemen. DLR-Interner Bericht. DLR-IB-AT-KP-2017-160. Bachelor's. Duale Hochschule Baden-Württemberg Mannheim. 115 S. |
| Paulat, U. (1990) Messung des Waermeuebergangsverhaltens einer stationaeren Rohrstroemung bei unterschiedlichen Einlaufgeometrien. Other. 112 S. Volltext nicht online. |
| Pesch, Melina (2022) Untersuchung des Einflusses von Fertigungsgenauigkeiten auf die aerodynamische Auslegung von subsonischen Verdichterprofilen. Master's, Technische Hochschule Köln. |
| Peters, Andreas and Beversdorff, Manfred and Bunde, Manfred and Dabrock, Theodor and Voges, Melanie and Voigt, Christian (2009) Experimentelle Untersuchung eines Verdichterlaufrades in Tandembauweise für hochbelastete Verdichter. DLR-Interner Bericht. DLR-IB 325-27-09. DLR Institut für Antriebstechnik. 56 S. (Unpublished) Volltext nicht online. |
| Peters, R. (1994) Leistungsanalyse fuer Dual-Mode-Staustrahlantriebe. DLR-Interner Bericht. 325-06-94. 185 S. Volltext nicht online. |
| Petzold, A. and Stein, C. and Nyeki, S. and Gysel, M. and Weingartner, E. and Baltensperger, U. and Giebl, H. and Hitzenberger, R. and Döpelheuer, A. and Vrchoticky, S. and Puxbaum, H. and Johnson, M. and Hurley, C.D. and Marsh, R. and Wilson, C.W. (2003) Properties of Jet Engine Combustion Particles during the PartEmis Experiment: Microphysics and Chemistry. Geophysical Research Letters, 30 (13), 52-1-52-4. doi: 10.1029/2003GL017283. Volltext nicht online. |
| Pfister, T. and Büttner, L. and Czarske, J. and Krain, H. and Schodl, R. (2006) Turbo machine tip clearance and vibration measurements using a fibre optic laser Doppler position sensor. Measurement Science and Technology, pp. 1-13. Volltext nicht online. |
| Pfister, Thorsten and Büttner, Lars and Czarske, Jürgen and Krain, Hartmut and Schodl, Richard (2008) Fiber optic laser Doppler distance sensor for in-situ tip clearance and vibration monitoring of turbo machines. In: 14th Int Symp on Applications of Laser Techniques to Fluid Mechanics, p. 11. 14th Int Symp on Applications of Laser Techniques to Fluid Mechanics, 2008-07-07 - 2008-07-10, Lisbon, Portugal. Volltext nicht online. |
| Pfizenmaier, E. (1996) Lärmbekämpfung bei schnellen Verkehrsmitteln. AGF-Forschung "Technik für die Umwelt", 1996, pp. 6-8. Volltext nicht online. |
| Pfizenmaier, E. (1995) Über konvektive und absolute Instabilitaet in Freistrahlen und Flammen. Seminar "Turbulente Strömungen" am HFI der TU Berlin, 31.01.1995.. Volltext nicht online. |
| Pfizenmaier, E. (1995) Lärmarme Stromabnehmer. Workshop "Stromabnehmer", DLR und Deutsche Bahn AG , Braunschweig, 11.07.1995. Volltext nicht online. |
| Pfizenmaier, E. (1995) Über die Vergleichbarkeit des mit verschiedenen Thromboplastinreagenzien und Blutgerinnungstestgeraeten ermittelten INR-Werten bei der Marcumarbehandlung - dargestellt an Messungen mit den Testgeraeten Biotrack 512 und CoaguCheck. DLR-Interner Bericht. 92517-95/B3. 49 S. Volltext nicht online. |
| Pfizenmaier, E. (1997) On abating pantograph noise demonstrated with elements of the DAS 350 SEK. 2nd International Workshop on the Aeroacoustics of High-Speed Trains, Berlin, 29.4.1997. Volltext nicht online. |
| Pfizenmaier, E. and Bechert, D. W. (1995) Beeinflussung der Profilverluste und Sekundärströmung durch Oberflächenstrukturen. ABB-DLR-Workshop, Baden/Schweiz, 20.10.1995. Volltext nicht online. |
| Pfizenmaier, E. and Blaschko, R. and Siemens, H. (1996) Experimentelle Untersuchungen zur Entwicklung auftriebsarmer Schleifleisten für den ICE im Niedergeschwindigkeitswindkanal der TU Dresden. Project Report, DLR-Interner Bericht. 92517-96/B1, Teil I: 105 S., 81 Bild., 7 Tab.; Teil II: 126 Tab.. Volltext nicht online. |
| Pfizenmaier, E. and Blaschko, R. (1) and Siemens, H. (2) (1996) Weitere experimentelle Untersuchungen zur Entwicklung auftriebsarmer Schleifleisten fuer Stromabnehmer des ICE im Windkanal der TU Dresden. DLR-Interner Bericht. 92517-96/B8 (1996); Teil I: 69 S., 61 Bild., 1 Lit., Teil II: 100 Tab.. Volltext nicht online. |
| Pfizenmaier, E. and King III, W. F. and Neuhaus, L. (1995) Experimentelle Untersuchungen an 1:10-Modellen des ICE 2.2 im Akustik-Windkanal der DLR in Braunschweig. DLR-Interner Bericht. 92517-95/B7. 58 S. Volltext nicht online. |
| Pfizenmaier, E. and King III, W.F. and März, J. and Herrmann, M. (1997) Akustische Untersuchungen an zwei Stromabnehmern der Firmen Adtranz und Siemens im DNW. DLR-Interner Bericht. 92517-97/B4. 119 S. Volltext nicht online. |
| Plohr, M. (1998) Experimentelle Untersuchung der 2-Phasen-Strömung einer Vorverdampferdüse für die magere, vorgemischte und vorverdampfte Verbrennung. DLR-Interner Bericht. Diploma. 105 S. Volltext nicht online. |
| Plohr, M. and Döpelheuer, A. and Lecht, M. (1999) The Gas Turbine Heat Cycle and its Influence on Fuel Efficiency and Emissions. In: Gas Turbine Operation and Technology for Land, Sea and Air Propulsion and Power Systems. RTO-Symposium Gas Turbine Operation and Technology for Land, Sea and Air Propulsion and Power Systems, Ottawa, Kanada, Oct. 99. Volltext nicht online. |
| Plohr, M. and von der Bank, R. and Schilling, T. (2003) Vergleich des Emissionsverhaltens effizienter Hochbypasstriebwerke mittlerer Schubgröße für den ICAO LTO-Zyklus und Flugmissionen. In: DGLR Jahrbuch 2003, (CD). DGLR. Deutscher Luft- und Raumfahrtkongress 2003, München, 17.-20. November 2003. Volltext nicht online. |
| Plohr, M, and Döpelheuer, A. and Lecht, M. (1999) The Gas Turbine Heat Cycle and its Influence on Fuel Effiency and Emissions. Gas Turbine Operation for Land, Sea and Air Propulsion and Power Systems, AVT Panel Meeting, Ottawa, Canada, 21.10.99. Volltext nicht online. |
| Pokorny, S. and Engel, K. and Faden, M. (1991) Lösung partieller DGL-Systeme mit TVD-Verfahren. Vortrag Universität Bonn, 26.11.91. Volltext nicht online. |
| Pokorny, S. and Faden, M. and Engel, K. (1991) An integrated flow simulation system on a parallel computer, part I: Basic Concept. 7th International Conference on Numerical Methods in Laminar and Turbulent Flow. Volltext nicht online. |
| Pokorny, S. and Faden, M. and Engel, K. (1991) Implementierung eines interaktiven Strömungssimulationssystems, Teil 1. GAMM Seminar "Numerische Algorithmen auf Transputersystemen", Juni 1991, Heidelberg. Volltext nicht online. |
| Pokorny, S. and Faden, M. and Engel, K. (1991) An Integrated Flow Simulation System on a parallel Computer, Part I: Basic Concept. 7th International Conference on Numerical Methods in Laminar and Turbulent Flow. Volltext nicht online. |
| Pokorny, S. and Faden, M. and Engel, K. (1991) Integriertes Strömungssimulationssystem auf einem Parallelrechner, Teil 1: Basis Konzept. Seminarvortrag IWR Heidelberg. Volltext nicht online. |
| Pokorny, S. and Faden, M. and Engel, K. (1991) Development of a Simulation System for 3-Dimensional Unsteady Turbomachinery Flow. In: Flow Simulation with High-Performance Computer I Notes on Numerical Fluid Mechanics, Vieweg Verlag. Vieweg. Volltext nicht online. |
| Pommerening, S. (1994) Charakterisierung einer Wasserstoffbrennkammer als Heissgasgenerator eines Duesenmodellpruefstandes fuer Grundlagenuntersuchungen zum Hyperschallantrieb. Other. 66 S. Volltext nicht online. |
| R. Fuchs, H.A. Schreiber (1992) Entwicklung einer Entwurfsmethode fuer transsonische Axialverdichter-gitter-Vorstellung des Vorhabens. Vortrag 4. Arbeitskreissitzung AG-Tubo-Turbotech, 16.-17.03.92 in Koeln-Porz. Volltext nicht online. |
| R. Schodl, (1992) Triebwerksmetechnik - Aufgaben, Struktur, Kooperationen, Ergebnisse. DLR-SM-AT-Seminar, Mai 1992. Volltext nicht online. |
| R. Schodl, (1992) Neue Entwicklungen beim L2F-Verfahren. Workshop: "Lasermethoden in der Stroemungsmeßtechnik", 29.-30.09.92 in Karlsruhe. Volltext nicht online. |
| R. Schodl, (1992) Development of 3D-Velocimeters based on the Laser2-Focus Technique. 11th Symposium on "Measuring Techniques for Transonic and Supersonic Flow in Cascades and Turbomachines", 14.-15.09.92, Muenchen. Volltext nicht online. |
| Rachner, M. (1998) Application of numerical spray simulation to accompany experiments in the LPP premise duct at DLR. BRITE/EURAM Low NOxIII - Focused Generics- Meeting No. 5, München, 10.02.1998. Volltext nicht online. |
| Rachner, M. (1999) Realgasverhalten und Phasengleichgewicht bei hohen Drücken. Instituts-Seminarvortrag, Inst. für Verbrennungstechnik, Stuttgart, 13.12.1999. Volltext nicht online. |
| Rachner, M. (1990) Calculation of Gas Turbine Combustion Chamber Flow on Staggered and Nonstaggered Grid. Deutsch-brasilianischer Workshop am Institut fuer Theoretische Stroem ungsmechanik der DLR, Goettingen, 6. Maerz 1990. Volltext nicht online. |
| Rachner, M. (1991) Flow computation in combustion chambers using zonal nonstaggered grids. AGARD PEP 77th Symp. on CFD Techniques for propulsion applications, San Antonio, Texas, USA, 27.-31.05.91. Volltext nicht online. |
| Rachner, M. (1996) Untersuchung zweier Modelle zur Beschreibung der turbulenten Partikeldispersion über der Lagrange'schen Partikelverfolgung. DLR-Interner Bericht. 325-13-96. 30 S. Volltext nicht online. |
| Rachner, M. (1996) Zum Einfluss der Anfangstropfengroessenverteilung auf die Sprayausbreitung im LPP-Vormischkanal. DLR-Interner Bericht. 325-14-96. 29 S. Volltext nicht online. |
| Rachner, M. (1998) Application of numerical spray simulation to accompany experiments in the LPP premix duct at DLR. DLR-Interner Bericht. 325-01-98. 31 S. Volltext nicht online. |
| Rachner, M. (1997) Stoffwerteformeln fuer Kerosin Jet A-1 im gasturbinenrelevanten Druckbereich auf der Basis einer kritischen Durchsicht von Literaturdaten. DLR-Interner Bericht. 325-03-97. 71 S. Volltext nicht online. |
| Rachner, M. and Becker, J. (2000) Modelling of the atomization of a plain liquid jet in crossflow in the LPP premise duct at DLR. DLR-Interner Bericht. 325-07-2000. 27 S. Volltext nicht online. |
| Rachner, M. and Brandt, M. and Eickhoff, H. and Hassa, C. and Braeuner, A. and Kraemer, H. and Ridder, M. and Sick, V. (1996) A Numerical and Experimental Study of Fuel Evaporation and Mixing for Lean Premixed Combustion at High Pressure. 26th Symposium on Combustion, Naples, Italy, July 28-August 2, 1996, erscheint in: Proceedings of the 26th Symp. Intern. of Combustion. Volltext nicht online. |
| Rachner, M. and Eickhoff, H. (1999) Ausbreitung, Verdunstung und Verbrennung von Sprays. CRAY-TECFLAM Abschlußkolloquium/14. TECFLAM-Seminar, TU Darmstadt, 19.03.1999. Volltext nicht online. |
| Rachner, M. and Koopman, J. (1991) Fundamentals and Application of CFD to Combustors. Space Course, Aachen, 18.02.-08.03.91. Volltext nicht online. |
| Rachner, M. and Schmitz, G. and Hassa, C. and Schütz, H. and Eickhoff, H. (1998) Numerische Untersuchung einer verdrallten Kerosin-Sprayflamme in einer Modellbrennkammer. In: erscheint in den Proceedings des 4. Workshop zur Technik der Fluidzerstäubung und Erfassung von Sprühvorgängen, 7-. Spray '98, Uni GH Essen, 13.-14.10.1998. Volltext nicht online. |
| Rachner, M. and Schütz, H. and Eickhoff, H. (1999) Entwicklung einer Software zur Simulation von technischen Verbrennungsvorgängen, Teilprojekt 1: Basiscodebereitstellung und Modellintegration. Project Report. BMBF-Förderkennzeichen: 0326839A. BMBF. 27 S. Volltext nicht online. |
| Rachner, M. and Schütz, H. and Theisen, P. (1999) KIVA-Online-Manual zum CRAY-TECFLAM-Projekt, darin die Kapitel "Equations for velocity, energy and k-epsilon-turbulence/Numerics" - Spray ISDM-model". Project Report, DLR-Interner Bericht. 49 S. Volltext nicht online. |
| Rachner, Michael (1998) Die Stoffeigenschaften von Kerosin Jet A-1. DLR-Mitteilungen 98-01 (1). |
| Rachner M., (2000) Modellierung der Zerstäubung eines flüssigen Strahls in einer Querströmung in einem LPP-Vormischkanal. Interner Workshop des DLR-Projekts Brennkammermodellierung, Inst. f. Antriebstechnik, DLR Köln, 23.11.2000. Volltext nicht online. |
| Rachwitz, L. and Dörr, T. and Heinze, J. and Jarius, M. and Stursberg, K. (2002) Experimentelle und theoretische Untersuchung des Brennstoffaufbereitung in mager vorgemischten Flammen. DGLR-2002-059, Stuttgart, 23.-26. September, 2002. Volltext nicht online. |
| Rackwitz, L. and Heinze, J. and Becker, J. (2004) Development of a piloted lean burner for an aero-engine combustor: influence of liquid fuel placement on pollutant emissions. In: 19th ilass Europe'04, 19, pp. 25-31. Alpha Graphics Nottingham. 19. Int. Conf. on Liquid Atomization and Spray Systems. Volltext nicht online. |
| Raede, M. (1995) Parametrische Analyse über den Einfluß des Bypass-Verhältnisses heutiger Luftfahrt-Triebwerke auf ihre Stickoxidemissionen. DLR-Interner Bericht. 325-05-95. 49 S. Volltext nicht online. |
| Raffel, M. and Schodl, R. and Bütefisch, K.A. and Kompenhans, J. and Willert, C. and Röhle, I. (1999) Über verschiedene Verfahren der optischen Messung der Strömungsgeschwindigkeit. DGLR Fachtagung, Meßtechnik und Sensorik für die Luftfahrt, Braunschweig, 1.-2. Juni 1999. Volltext nicht online. |
| Raitor, T. and Neise, W. and Hoffmann, B. and Mönig, R. (2007) Schallreduzierung bei Radialverdichtern (Radialverdichterlärm IIb). Abschlussbericht über das Vorhaben FVV-Nr. 901 (AIF-Nr. 14733N/1). In: Forschungsvereinigung Verbrennungskraftmaschinen, Heft R 538, pp. 113-150. Informationstagung Turbomaschinen, FVV-Frühjahrstagung, 2007-03-22, Frankfurt/Main. Volltext nicht online. |
| Raitor, T. and Neise, W. and Hoffmann, B. and Mönig, R. (2007) Schallreduzierung bei Radialverdichtern (Radialverdichterlärm IIb). Abschlussbericht über das Vorhaben FVV-Nr. 901 (AIF-Nr. 14733N/1). Project Report. Other. Volltext nicht online. |
| Raitor, T. and Neise, W. and Hoffmann, B. and Mönig, R. and Enghardt, L. (2009) Schallemission von Radialverdichtern mit Kompaktdiffusor (Radialverdichterlärm III, Abschlussbericht zum Vorhaben 949). In: FVV Informationstagung Turbomaschinen, Frühjahrstagung 2009, Heft R546, Heft R546, pp. 141-175. Forschungsvereinigung Verbrennungskraftmaschinen. Informationstagung Motoren/Turbomaschinen, FVV-Frühjahrstagung 2009, 2009-04-02, Bad Neuenahr. Volltext nicht online. |
| Raitor, T. and Neise, W. and Hoffmann, B. and Mönig, R. and Enghardt, L. (2009) Schallemission von Radialverdichtern mit Kompaktdiffusor. (Radialverdichterlärm III, Abschlussbericht zum Vorhaben 949). Project Report. Volltext nicht online. |
| Raitor, T. and Neise, W. and Mönig, R. (2004) Schallentstehung bei Radialverdichtern. Abschlussbericht über das Vorhaben Nr. 781 (AIF-Nr. 13041 N). Informationstagung Turbinen, FVV-Herbsttagung, Pforzheim, 23. September 2004. Volltext nicht online. |
| Raitor, T. and Neise, W. and Mönig, R. (2004) Schallentstehung bei Radialverdichtern. Abschlussbericht über das Vorhaben Nr. 781 (AIF-Nr. 13041 N). Forschungsvereinigung Verbrennungskraftmaschinen, 787 (787). Volltext nicht online. |
| Rasouli Ghazi Kalayeh, Keyvan and Jeschke, Peter and Kluxen, Robert and Schäfer, Philipp (2014) Numerical evaluation of different hub geometries in an exhaust diffuser. Master's, RWTH Aachen. Volltext nicht online. |
| Rasouli Ghazi Kalayeh, Keyvan and Schäfer, Philipp and Finzel, Conrad and Hofmann, Willy (2015) Experimental And Numerical Study Of A Gas Turbine Exhaust Diffuser Applying Different Hub Extension Geometries. In: 11th European Turbomachinery Conference. EUROPEAN TURBOMACHINERY CONFERENCE, 2015-03-23 - 2015-03-27, Madrid, Spanien. Volltext nicht online. |
| Rehder, H.-J. (2001) Nozzle Guide Vane Assembly Modifications at the Windtunnel for Rotating Cascades (RGG). DLR-Interner Bericht, Project Report. 225-2001 A 03. 17 S. Volltext nicht online. |
| Rehder, H.-J. (2004) DLR Flow Field Measurements - European Research Project AITEB -. DLR-Interner Bericht, Project Report. 225-2004 A 12. 70 S. Volltext nicht online. |
| Rehder, H.-J. and Dannhauer, A. (2004) DLR Rig Instrumentation -European Research Project AITEB-. DLR-Interner Bericht, Project Report. 225-2004 A 08. Volltext nicht online. |
| Rehder, H.-J. and Kost, F. and Kessar, A. (2003) Low Engine Order NGV Only Tests at DLR. DLR-Interner Bericht. 225-2003 A 06. 47 S. Volltext nicht online. |
| Rehder, H.-J. and Kost, F. and Kessar, A. (2005) Low Engine Order Stage Tests at DLR (Time-Averaged Results). DLR-Interner Bericht, Project Report. 225-2005 A 02. 100 S. Volltext nicht online. |
| Rehder, Hans-Jürgen (2015) Massenflussmessungen am Turbinenprüfstand NG-Turb. DLR-Interner Bericht. DLR - IB 225 - 2015 A01. Institut für Antriebstechnik. (Unpublished) Volltext nicht online. |
| Reitenbach, Stanislaus and Schnoes, Markus and Becker, Richard-Gregor and Otten, Tom (2015) OPTIMIZATION OF COMPRESSOR VARIABLE GEOMETRY SETTINGS USING MULTI-FIDELITY SIMULATION. ASME Turbo Expo 2015, 2015-06-15 - 2015-06-19, Montreal, Kanada. doi: 10.1115/GT2015-42832. ISBN 978-0-7918-5665-9. Volltext nicht online. |
| Ren, Celine (2010) Calibration of a four-hole mini probe in sub-, trans- and supersonic flow. DLR-Interner Bericht. DLR-IB 225-2010 A08. Institut für Antriebstechnik. Volltext nicht frei. |
| Reyl, M. and Elfert, M. (1992) Experimentelle Analyse der Stroemung in einem rotirenden Kanal mit Hilfe eines L2F-Velozimeters. DLR-Interner Bericht. 325-05-92. SM-AT. 160 S. Volltext nicht online. |
| Ripplinger, T. and Brandt, M. and Hassa, C. (1996) Schadstoffreduktion durch Magerverbrennung und Vorvermischung und Messung der Zweiphasen-Strömung. Sekretariat AG-Turbo, 51170 Köln. Volltext nicht online. |
| Ripplinger, Th. and Zarzalis, N. and Brandt, M. and Hassa, C. (1998) Entwicklungsstadien eines Konzeptes zur mageren Verbrennung mit Vorverdampfung und Vorvermischung des flüssigen Brennstoffs. In: 6. Statusseminar Arbeitsgemeinschaft Hochtemperatur Gasturbine, 3-1-3-11. 6. Statusseminar AG Turbo, DLR Köln, 3.12.1998. Volltext nicht online. |
| Ripplinger, Th. and Zarzalis, N. and Meikis, G. and Hassa, C. and Brandt, M. (1998) NOx Reduction by Lean Premixed Prevaporized Combustion. In: Gas Turbine Engine Combustion, Emissions and Alternative Fuels, 7-1-7-12. RTO Symposium, Lissabon, Portugal, 12.10.1998. ISBN 92-837-0009-0. Volltext nicht online. |
| Roehle, I. (2000) Doppler global Velocimetry: Grundlagen und Anwendungen. Beitrag zu einem Lehrgang, TU Darmstadt, 9.-11. Okt. 2000. Volltext nicht online. |
| Roehle, I. (1993) Velocity Measurements with the Doppler Global Technique. Vortrag auf der Tagung "Euromech 309" vom 28.09.-01.10.93, DLR Goetti ngen. Volltext nicht online. |
| Roehle, I. (1996) Three-Dimensional Doppler Global Velocimetry in the flow of a fuel spray nozzle and in the wake region of a car. Flow Measurement Instrumentation, No 3/4, pp. 287-294. Volltext nicht online. |
| Roehle, I. and Schodl, R. (1994) Evaluation of the accuracy of the Doppler Global technique. Vortrag auf der Tagung "Optical Methods and Dato Processing on Heat a nd Fluid Flows", 14.-15. April 1994 in London. Volltext nicht online. |
| Roehle, I. and Schodl, R. (1994) Evaluation of the accuracy of the Doppler Global technique. Volltext nicht online. |
| Roehle, I. and Schodl, R. (1994) Geschwindigkeitsmessungen mit Doppler-Global-Velocimetry. Vortrag am Institut Saint Louis, 13.12.1994. Volltext nicht online. |
| Roehle, I. and Schodl, R. (1994) Beschreibung des 3D-Doppler-Laser-Zwei-Fokus-Verfahrens. DLR-Interner Bericht. 325-15-94. 30 S. Volltext nicht online. |
| Roehle, I. and Schodl, R. (1994) Fortschritte in der Doppler Global Velocimetry. Vortrag bei der DLR-internen Konferenz LIF 7 in Stuttgart Konferenzproceeding "LIF 7". Volltext nicht online. |
| Roehle, I. and Schodl, R. (1994) Progress Report Doppler Global Velocimetry. DLR-ONERA-Messtechnik-Kooperation, Treffen in Lampoldshausen. Volltext nicht online. |
| Roehle, I. and Schodl, R. (1996) Demonstration eines DGV-Systems im Windkanal bei Mercedes Benz. Demonstrationsversuch bei Mercedes Benz in Sindelfingen, 14.6.96. Volltext nicht online. |
| Roehle, I. and Schodl, R. (1996) Doppler Global Velocimetry in the Flow of a Swirler. 8th International Symposium on Applications of Laser Techniques to Fluid Mechanics, Lissabon, Portugal. Volltext nicht online. |
| Roehle, I. and Schodl, R. (1996) Doppler Global Velocimetry in the Flow of a Swirler and in the Wake Region of a Car. Vortrag bei NASA-Langley, 4.04.96. Volltext nicht online. |
| Roehle, I. and Schodl, R. (1996) Doppler Global Velocimetry in der Stroemung einer Drallduese und im Nachlauf eines PKW-Modells bei Mercedes Benz. Vortrag auf LIF 8, 18.-10.12.1996, Koeln. Volltext nicht online. |
| Roehle, I. and Schodl, R. (1997) 3D-Doppler-Global Velocimetry in the Flow of a Fuel Spray Nozzle and in the Flow of an Engine Inlet Model. 90th Symposium of AGARD-PEP on Advanced Non-Intrusive Instrumentation for Propulsion Engines, Oct. 20-24, 1997, Bruessel. Volltext nicht online. |
| Roehle, I. and Schodl, R. (1997) Application of Three-dimensional Doppler-Global Velocimetry to Turbomachinery and Wind-Tunnel Flow. In: Proceedings 7th Int. Conf. "Laser Anemometry Advances and Applications" 1997. 7th Int. Conference "Laser Anemometry Advances and Applications", Sept. 8-11, Karlsruhe, 1997. Volltext nicht online. |
| Roehle, I. and Voigt, P. and Schodl, R. and Willert, C. (2000) Recent developments and applications of quantitative planar measuring techniques in turbomachinery components. Measurements Science & Technology, 11 (11), pp. 1023-1035. Volltext nicht online. |
| Roehle, I. and Willert, C. (2001) Extension of Doppler Global Velocimetry to periodic flows. Measurement, Science Technology, Institute of Physics Publishing, April 2001 (2001), 12 (4), pp. 420-431. Volltext nicht online. |
| Roehle, I. and Willert, C. and Schodl, R. (1998) Applications of Three-Dimensional Doppler Global Velocimetry in Turbo-Machinery. 8th International Symposium on Flow Visualisation, Sorrento, Italien, 1-4 Sept. 1998. Volltext nicht online. |
| Roehle, I. and Willert, C. and Schodl, R. (1998) Recent Applications of Three-Dimensional Doppler-Global Velocimetry in Turbo-Machinery. 9th International Symposium on Applications of Laser Techniques to Fluid Mechanics, Lisbon, Portugal, 13-16 July, 1998. Volltext nicht online. |
| Roehle, I. and Schodl, R. (1992) Untersuchungen zur Ermittlung des Genauigkeitspotentials der Doppler Global Mehtode zur 2D-Geschwindigkeitsanalyse. DLR-SM-AT-Seminar , 1992, Göttingen. Volltext nicht online. |
| Roehle, Ingo (1993) Laser-Doppler-Velocimetry auf der Basis frequenzselektiver Absorption. DLR-Interner Bericht. 325-08-93. Diploma. 120 S. Volltext nicht online. |
| Rost, W. and Schnell, R. (2004) Numerische Untersuchung der Zwischendiffusorströmung eines Flugtriebwerkes. DLR-Interner Bericht. 325-15-04. Diploma. 59 S. Volltext nicht online. |
| Röber, T, and Kozulovic, D, and Kügeler, E, and Nürnberger, D, (2005) Appropriate Turbulence Modelling for Turbomachinery Flows. In: Strömungen mit Ablösung, 14. DGLR-Fach-Symposium Bremen, 14. - 16. November 2004. Springer Verlag. 14th DGLR-Symposium of STAB, Bremen, Nov 16-18, 2004. Volltext nicht online. |
| Röhle, I. (1998) Doppler Global Velocimetry. VKI-Brüssel, B. Lecture Series, Advanced Measurement Techniques, Brüssel-VKI, Juni 1998. Volltext nicht online. |
| Röhle, I. (1999) Doppler Global Velocimetry; Principle and Application I+II. Planar optical measurement techniques for Gas Turbine components, RTO Lecture Series, Cleveland, USA, Sept. 99. Volltext nicht online. |
| Röhle, I. (1999) Doppler Global Velocimetry. In: Planar Optical Measurement Methods for Gas Turbine Components, 217, 4.1-4.22. RTO, F-92201 Neuilly sur Seine, France. Lecture Series, Cranfield, GB, 16.-17.Sept. 99/Cleveland, USA, 21.-22.Sept. 99. Volltext nicht online. |
| Röhle, I. (1999) Doppler Global Velocimetry: Grundlagen und Anwendungen. In: Strömungsmesstechnik in der industriellen Forschung, 23.1-23.45. TU Darmstadt, FB Strömungslehre. Kurzlehrgang Strömungsmesstechnik in der industriellen Forschung, Darmstadt, 11.-14. Okt. 1999. Volltext nicht online. |
| Röhle, I. (2001) Application of novel developed laser diagnostic techniques to turbo-machinery facilities. 1. Preis für die Dissertation, Pratt & Whitney /EREA Award 2001, Verleihung in Brüssel, 9. Mai, 2001. Volltext nicht online. |
| Röhle, I. and Fradin, C. and LeGuevel, A. (1998) Traces based Shock Visualisation in the Blade Passage of the Rotor of a Transonic Axial Compressor. IMechE, Birdcagewalk 1, London. Optical Methods in Heat and Fluid Flow, City University, London, 16.-17.April 1998. ISBN 186058 1420 / ISSN 1356-1448. Volltext nicht online. |
| Röhle, I. and Fradin, C. and LeGuevel, A. (1999) Tracer-based Shock Visualisation in a Transonic Compressor. Journal Optics & Laser Technology, 31 (1), pp. 67-73. Volltext nicht online. |
| Röhle, I. and Karpinski, G. and Schodl, R. (1999) 3C-Doppler-L2F: A new Kind of Three Component Anemometer. ONERA, Toulouse, France. 18th International Congress on Instrumentation in Aerospace Simulation Facilities (ICIASF), Toulouse, France, 14.-17. June 199. Volltext nicht online. |
| Röhle, I. and Schodl, R. (1995) Flächige Echtzeit-Geschwindigkeitsmessung mit Doppler-Global-Velocimetrie. Zentrumskolloquium, Göttingen, 2./3.11.1995. Volltext nicht online. |
| Röhle, I. and Schodl, R. (1995) Doppler-Global-Geschwindigkeitsmessungen an einer Dralldüse. Zentrumskolloquium Göttingen, 2./3.11.1995. Volltext nicht online. |
| Röhle, I. and Schodl, R. (1996) Praesentation eines DGV-Systems und Demo-DGV-Messungen in einem Windkanal an einem PKW-Modell. Vortrag bei Mercedes-Benz, 14.6.96, Stuttgart. Volltext nicht online. |
| Röhle, I. and Schodl, R. and Voigt, P. and Willert, C. (2000) Recent developments and applications of quantitative laser light sheet measuring techniques in turbomachinery components. Measurement, Science & Technology, 11 (7), pp. 1023-1035. Volltext nicht online. |
| Röhle, I. and Schodl, R. and Weyer, H.B. (1998) 3D-Shock Visualization in a Transonic Compressor. International Workshop "Flow Diagnosis Techniques", St. Petersburg, June 30 - July 3, 1998. Volltext nicht online. |
| Röhle, I. and Willert, C. and Bake, F. (2004) Micro DVG and Filtered Rayleigh Scattering - two challenging techniques using iodine cells. DLR/ONERA - Annex II Meeting, Köln, 6. - 7. April 2004. Volltext nicht online. |
| Röhle, I. and Willert, C. and Schodl, R. (1998) Applications of Three-Dimensional Doppler Global Velocimetry in Turbo-Machinery. In: Proc. 8th International Symposium on Flow Visualization, 157.1-157.10. 8th International Symposium on Flow Visualization, Sorrento, Italia, 1.-4. Sept. 1998. Volltext nicht online. |
| Röhle, I. and Willert, C. and Schodl, R. (1998) Recent Applications of Doppler Global Velocimetry in Turbo-Machinery. 9th Symposium on Applications of Laser Techniques to Fluid Mechanics, Lisbon, Pt, 13.-16. Juli 1998. Volltext nicht online. |
| Röhle, Ingo (1999) Laser Doppler Velocimetry auf der Basis frequenzselektierter Absorption: Aufbau und Einsatz eines Doppler Global Velocimeters. DLR-Forschungsbericht. 1999-40. Dissertation. 180 S. Volltext nicht online. |
| Römer, H. (1991) Erstellung und Auswertung von numerischen, sowie Auswertung von experimentell gewonnenen Daten für einen rotierenden Kühlkanal. DLR-Interner Bericht. 325-14-91. 109 S. Volltext nicht online. |
| Röpernack, Clara (2020) Auslegung und Analyse von verstellbaren Störkörpern zur experimentellen Nachbildung variabler Einlaufstörungen von turbulenten Wandgrenzschichten. Bachelor's, Hochschule für Technik und Wirtschaft Berlin. Volltext nicht online. |
| S. Pokorny, K. Engel, M. Faden, (1992) Berechnung der instatioinaeren Stroemung im gegenlaeufigen Geblaese. Kolloquium Energietechnik Ruhr-Uni Bochum. Volltext nicht online. |
| S. Pokorny, K. Engel, M. Faden, (1992) Development of a 3-D flow simulation system on a parallel computer for turbomachinery. In: Volltext nicht online. |
| S. Pokorny, K. Engel, M. Faden, (1992) Objektoriedntierte Methoden in der Stroemungsmechanik fuer massiv parallele Rechner. Kolloquium Stroemungsmaschinen Universitaet Essen, 29.06.92. Volltext nicht online. |
| Salom, R. (2002) Konstruktion für optische Strömungsuntersuchungen in einem Hubkolbenmotor. DLR-Interner Bericht. 325-05-02. Diploma. Volltext nicht online. |
| Sauermann, Marc (2021) Grundlagenermittlung und Vorauslegung der „Future-Propulsion-Test-Facility“ (FPT) mit Fokus auf den prozesstechnischen Führungsgrößen. Master's, Technische Hochschule Köln. Volltext nicht frei. |
| Sausen, R. and Nodorp, D. and Land, C. and Deidewig, F. (1996) Ermittlung optimaler Flughöhen und Flugrouten unter dem Aspekt minimaler Klimawirksamkeit. DLR-Forschungsbericht. 96-13. 105 S. Volltext nicht online. |
| Schade, Stephen and Jaron, Robert and Moreau, Antoine and Guerin, Sebastien (2021) Mechanisms to reduce the blade passing frequency tone for subsonic low-count OGV fans. Aerospace Science and Technology (125). Elsevier. doi: 10.1016/j.ast.2021.107083. ISSN 1270-9638. Volltext nicht frei. |
| Schade, Stephen and Merino-Martínez, Roberto and Ratei, Patrick and Bartels, Susanne and Jaron, Robert and Moreau, Antoine (2024) Initial Study on the Impact of Speed Fluctuations on the Psychoacoustic Characteristics of a Distributed Propulsion System with Ducted Fans. In: 30th AIAA/CEAS Aeroacoustics Conference, 2024. American Institute of Aeronautics and Astronautics. 30th AIAA/CEAS Aeroacoustics Conference (2024), 2024-06-04 - 2024-06-07, Rom, Italien. doi: 10.2514/6.2024-3273. ISBN 978-162410720-7. Volltext nicht frei. |
| Schaefer, Martin and Grimme, Wolfgang (2008) The variability of air transport's specific emissions and implications for airline strategies. First CEAS European Air and Space Conference, 2007-09-10 - 2007-09-13, Berlin. Volltext nicht online. |
| Schaefer, Martin and Jung, Martin and Pabst, Holger (2013) The Regional Distribution of Air Traffic Emissions in the Past, Present and Future. In: Deutsche Nationalbibliothek. Deutscher Luft- und Raumfahrtkongress 2013, 2013-09-10 - 2013-09-12, Stuttgart, Deutschland. Volltext nicht online. |
| Scheelhaase, Janina and Keimel, Hermann and Murphy, Melanie and Sausen, Robert and Schaefer, Martin and Wolters, Florian (2012) How to address aviation's full climate impact best from an economic point of view? - AviClim project overview and first results. Air Transport Research Society (ATRS) 2012 Tainan, 2012-06-27 - 2012-06-30, Tainan, Taiwan. Volltext nicht online. |
| Scheelhaase, Janina and Murphy, Melanie and Keimel, Hermann and Sausen, Robert and Schaefer, Martin and Wolters, Florian (2013) How to address aviation's full climate impact best from an economic point of view? - AviClim project overview and update on first results. In: XIII World Conference on Transport Research (WCTR) Proceedings. XIII World Conference on Transport Research (WCTR), 2013-07-15 - 2013-07-18, Rio de Janeiro, Brasilien. Volltext nicht online. |
| Scheelhaase, Janina and Schaefer, Martin and Grimme, Wolfgang and Maertens, Sven (2013) Cost Impacts of the EU Emissions Trading Scheme on Aviation in the Time Period 2012 - 2020. Annual Transportation Research Forum 2013, 2013-03-21 - 2013-03-23, Annapolis, USA. (Unpublished) Volltext nicht online. |
| Scheelhaase, Janina and Dahlmann, Katrin and Jung, Martin and Keimel, Hermann and Murphy, Melanie and Nieße, Hendrik and Sausen, Robert and Schaefer, Martin and Wolters, Florian (2015) Die Einbeziehung des Luftverkehrs in internationale Klimaschutzprotokolle (AviClim) - Abschlussbericht. DLR-Forschungsbericht. DLR e. V.. 191 S. |
| Scheelhaase, Janina and Dahlmann, Katrin and Jung, Martin and Keimel, Hermann and Nieße, Hendrik and Sausen, Robert and Schaefer, Martin and Wolters, Florian (2016) How to best address aviation’s full climate impact from an economic policy point of view? – Main results from AviClim research project. Transportation Research Part D: Transport and Environment (45), pp. 112-125. Elsevier. doi: 10.1016/j.trd.2015.09.002. ISSN 1361-9209. |
| Scheelhaase, Janina and Dahlmann, Katrin and Jung, Martin and Keimel, Hermann and Nieße, Hendrik and Sausen, Robert and Schaefer, Martin and Wolters, Florian (2020) Scenarios for future policies – potential costs and competitive impacts of different market-based measures for the limitation of all climate relevant species from aviation. In: Aviation and Climate Change – Economic Perspectives on Greenhouse Gas Reduction Policies Routledge. pp. 202-220. doi: 10.4324/9781315572406-11. ISBN 978-1-315-57240-6. Volltext nicht online. |
| Scheelhaase, Janina and Sausen, Robert and Dahlmann, Katrin and Jung, Martin and Keimel, Hermann and Nieße, Hendrik and Schaefer, Martin and Wolters, Florian (2015) Economic and Environmental Impacts of Market-Based Measures for the Limitation of Aviation’s full Climate Impact. In: Proceeding of the 2015 TRF Annual Forum. 2015 TRF Annual Forum, 2015-03-12 - 2015-03-14, Atlanta, USA. Volltext nicht online. |
| Scheelhaase, Janina and Sausen, Robert and Dahlmann, Katrin and Jung, Martin and Keimel, Hermann and Nieße, Hendrik and Schaefer, Martin and Wolters, Florian (2016) Factors determining airlines' costs for climate protecting market-based measures. In: Proceedings of the 14th World Conference on Transport Research (WCTR), pp. 1-16. Elsevier B. V.. 14th World Conference on Transport Research (WCTR), 2016-07-10 - 2016-07-15, Shanghai, China. ISSN 2214-241X. |
| Scheelhaase, Janina/JS and Sausen, Robert/RS and Dahlmann, Katrin/KD and Jung, Martin/MJ and Keimel, Hermann/HK and Nieße, Hendrik/HN and Schaefer, Martin/MS and Wolters, Florian/FW (2014) Best options for regulating air transport’s full climate impact from an economic and en-vironmental point of view – Main results from DLR research project AviClim. World Conference of Air Transport Society (ATRS) 2014, 2014-07-17 - 2014-07-20, Bordeaux, Frankreich. Volltext nicht online. |
| Scheelhaase, Janina/JS and Sausen, Robert/RS and Dahlmann, Katrin/KD and Jung, Martin/MJ and Keimel, Hermann/HK and Nieße, Hendrik/HN and Schaefer, Martin/MS and Wolters, Florian/FW (2014) Best options for regulating air transport’s full climate impact from an economic and environmental point of view – Main results from DLR research project AviClim. In: AIAA/3AF Aircraft Noise and Emissions Reduction SYmposium (ANERS) 2014 Proceedings. AIAA/3AF Aircraft Noise and Emissions Reduction Symposium (ANERS), 2014-06-18 - 2014-06-20, Atlanta, USA. Volltext nicht online. |
| Schimming, P. (1999) Entwicklungstendenzen bei luftatmenden Triebwerken aus Sicht der Forschung. Lehrgang "Aktuelle Triebwerkstechnologie" an der Bundesakademie für Wehrverwaltung und Wehrtechnik, Mannheim, 24.9.99. Volltext nicht online. |
| Schimming, P. (1999) Triebwerksverdichter: Transsonikverdichter I. Seminarvortrag, Ruhr-Universität Bochum, 19.5.99. Volltext nicht online. |
| Schimming, P. (1999) Strömungsuntersuchungen in einem 5-stufigen Axialverdichter. 18. Arbeitskreissitzung Turbotech II, Köln-Porz, 11.03.99. Volltext nicht online. |
| Schimming, P. (1999) 3D-Lasermessungen und Rechnungen in transsonischen Verdichtern. Vortrag ABB Alston Power, Baden, Schweiz, 29.11.1999. Volltext nicht online. |
| Schimming, P. (1999) NAL/DLR-Cooperation in Aero-Propulsion. Workshop at NAL, Tokyo, Japan, 11.01.99. Volltext nicht online. |
| Schimming, P. (1999) Triebwerksverdichter: Propfans. Seminarvortrag Ruhr-Universität Bochum, 23.06.99. Volltext nicht online. |
| Schimming, P. (2000) Entwicklung umweltfreundlicher Triebwerke. Fachtagung der Sicherheitsingenieure -Luft- und Raumfahrt-, DLR Köln-Porz. 15.6.2000. Volltext nicht online. |
| Schimming, P. (2000) Triebwerksverdichter: Propfans. Seminarvortrag, RUB Bochum, 5.07.2000. Volltext nicht online. |
| Schimming, P. (2000) Triebwerksverdichter: Transsonikverdichter. Seminarvortrag, RUB, 28.06.2000. Volltext nicht online. |
| Schimming, P. (1990) Aerothermodynamik von gegenlaeufigen, ummantelten Propfangeblaesen. Statusbericht der Projektgruppe Propfan bei der MTU, 10. Januar 1990, Muenchen. Volltext nicht online. |
| Schimming, P. (1991) Welchen Beitrag können strömungsmechanische Untersuchungen an Verdichtern/Fans zur aerodynamischen Integration und Aeroaktustik leisten? Leistungs-, Integrations- und Aeroakustikuntersuchungen mit Modelltriebwerken, DNW/NL, 11.1191. Volltext nicht online. |
| Schimming, P. (1991) 3D-Flow Analysis using Experimental and Numerical Data Received in a Ducted Propfan Rotor. DLR-ONERA-Meeting in Châtillon (F), 21./22.02.91. Volltext nicht online. |
| Schimming, P. (1995) Gegenläufige ummantelte Gebläse. Kolloquium Luftfahrttechnik, Technische Hochschule Darmstadt, 10.1.1995. Volltext nicht online. |
| Schimming, P. (1995) Experimentelle und numerische Ergebnisse erzielt an Turbomaschinenkomponenten. BMW Rolls-Royce, Dahlewitz bei Berlin, 29.5.1995. Volltext nicht online. |
| Schimming, P. (1995) Experimentelle und numerische Ergebnisse erzielt an Turbomaschinenkomponenten. Vortrag bei ABB, Baden (Schweiz), 24.03.1995. Volltext nicht online. |
| Schimming, P. (1995) Gegenläufige, ummantelte Gebläse. Seminarvortrag an der TU-Berlin, 09.06.1995. Volltext nicht online. |
| Schlüß, Daniel and Frey, Christian (2018) Time Domain Flutter Simulations of a Steam Turbine Stage Using Spectral 2D Non-Reflecting Boundary Conditions. 15th International Symposium on Unsteady Aerodynamics, Aeroacoustics & Aeroelasticity of Turbomachines (ISUAAAT15), 2018-09-24 - 2018-09-27, Oxford. |
| Schmelcher, Marc and Görtz, Alexander and Häßy, Jannik and El-Soueidan, Mahmoud and Nöske, Fabian Torsten (2024) Integration of Heat Exchanger Models into the Performance Analysis of Innovative Aero Engine Architectures. In: International Society of Air Breathing Engines, Proceedings, 2024. ISABE 2024, 2024-09-22 - 2024-09-27, Toulouse, Frankreich. |
| Schmieder, A. (1996) Untersuchung des Einflusses der Strahlmischung auf das Betriebsverhalten von ZTL-Triebwerken. DLR-Interner Bericht. 325-12-96. 72 S. Volltext nicht online. |
| Schmitt, A. and Brunner, B. and Deidewig, F. and Lecht, M. and Koehler, I. and Sausen, R. (1996) Verteilung und Auswirkung der Emissionen des zivilen Kurzstreckenverkehrs mit strahlgetriebenen Flugzeugen. Volltext nicht online. |
| Schmitt, A. and Lecht, M. (1995) Emissionskataster für die Schadstoffe in der Luftfahrt. In: Systemanalyse und Technikfolgenabschätzung Campus Verlag , Frankfurt am Main. pp. 83-93. Volltext nicht online. |
| Schmitt, S. (1998) Simulation der instationären Strömung in Turbomaschinen. Kolloquium Triebwerkstechnologie, Bonn, 10.12.1998. Volltext nicht online. |
| Schmitt, S. (2000) TRACE-Numerische Simulation von Strömungen in Turbomaschinen. Meeting DLR-KWU, Mülheim, 23.05.2000. Volltext nicht online. |
| Schmitt, S. (2000) Erweiterung eines parallelen und zeitgenauen Navier-Stokes-Verfahrens auf aeroelastische Anwendungen. Kolloquium Energietechnik der Ruhr-Universität Bochum, Bochum, 02.02.2000. Volltext nicht online. |
| Schmitt, S. (1999) Erweiterung eines parallelen und zeitgenauen Navier-Stokes-Verfahrens auf aeroelastische Anwendungen. DASA-DLR Nachwuchsinitiative, DASA-Standort Manching, 25.11.1999. Volltext nicht online. |
| Schmitt, S. (1999) Experimental Data for Test Case 4. Project Report. BRPR-CT-97-0610. EU. 9 S. Volltext nicht online. |
| Schmitt, S. (1999) Technical Report on the NASA Rotor 37 (Test Case 2). Project Report. BRPR-CT97-0610. EU. 12 S. Volltext nicht online. |
| Schmitt, S. (2000) Synthesis report on the Propfan. Project Report. EU. 26 S. Volltext nicht online. |
| Schmitt, S. (2003) Simulation von Flattern und aerodynamischer Zwangserregung in Turbomaschinenbeschaufelungen. DLR-Forschungsbericht. 2003-22. Dissertation. 186 S. Volltext nicht online. |
| Schmitt, S. and Aubé, M. (2000) Synthesis of calculations performed on the contra-rotating fan from DLR. Project Report. EU. 26 S. Volltext nicht online. |
| Schmitt, S. and Carstens, V. (2003) Numerical Simulation of Flutter and Forced Response in Turbomachines. 1st International Exhibition of Youth's Creative Work in Aerospace Technologies (UNIMAKS) on Moscow International Aviation & Space Salon, Zhukovsky/Moscow (Russia), Aug. 19-24 2003. Volltext nicht online. |
| Schmitt, S. and Carstens, V. (2003) Simulation von Flattern und aerodynamischer Zwangserregung in Turbomaschinen. In: Wissenschaftliches Kolloquium "Gasturbinenforschung - ein Kerngebiet des DLR" zu Ehren von Prof. Winterfeld. Wissenschaftliches Kolloquium "Gasturbinenforschung - ein Kerngebiet des DLR" zu Ehren von Prof. Winterfeld, Köln, 15. Okt. 2003. Volltext nicht online. |
| Schmitt, S. and Carstens, V. (2000) Erweiterung von TRACE-U auf aeroelastische Anwendungen. DLR-MTU Workshop zu TRACE-U, München, 20.-21.01.2000. Volltext nicht online. |
| Schmitt, S. and Carstens, V. (2000) Application of Direct Fluid-Structure Coupling to a Vibrating Compressor Cascade. 2nd Int. Conference on Applied Mathematics for Industrial Flows, Tuscany, Italy, 12-14 Oct. 2000. Volltext nicht online. |
| Schmitt, S. and Eulitz, F. and Nürnberger, D. and Carstens, V. (1999) Numerische Simulation schwingender Turbomachinenschaufeln durch Vorgabe harmonischer Bewegungen und durch direkte Strömung-Struktur-Kopplung. 9. AG STAB-Workshop, Göttingen, 9.-10.11.1999. Volltext nicht online. |
| Schmitt, S. and Eulitz, F. and Nürnberger, D. and Carstens, V. and Belz, J. (2001) Simulation of Propfan Forced Response using a Direct Fluid-Structure Coupling Method. Proceedings 4th European Conference on Turbomachinery Fluid Dynamics and Thermodynamics, Florence, Italy, 20-23 March 2001. Volltext nicht online. |
| Schmitt, S. and Eulitz, F. and Nürnberger, D. and Vogel, D.T. (2000) NASA Rotor 37 Test Case Computations. Proceedings ERCOFTAC-APPACET Seminar and Workshop on Turbomachinery Flow Prediction VIII, La Clusaz, France, 19.-23.03.2000. Volltext nicht online. |
| Schmitt, S. and Eulitz, F. and Nürnberger, D. and Wallscheid, L. (2000) Comparison of propfan test case computations. Proceedings ERCOFTAC-APPACET Seminar and Workshop on Turbomachinery Flow Prediction VIII, La Clusaz, France, 19.-23.03.2000. Volltext nicht online. |
| Schmitt, S. and Eulitz, F. and Nürnberger, D. and Wallscheid, L. (2000) DLR's Propfan "CRISP" Test Case Computations. ERCOFTAC-APPACET Seminar and Workshop on Turbomachinery Flow Prediction VIII, La Clusaz, France, 19.-23.03.2000. Volltext nicht online. |
| Schmitt, S. and Eulitz, F. and Nürnberger, D. and Wallscheid, L. (2000) DLR's Counter Rotating Fan "CRISP" as a Testcase for the Evaluation of Unsteady Turbomachinery Flow Solvers. Proceedings ERCOFTAC-APPACET Seminar and Workshop on Turbomachinery Flow Prediction VIII, La Clusaz, France, 19.-23.03.2000. Volltext nicht online. |
| Schmitt, S. and Eulitz, F. and Wallscheid, L. and Arnone, A. and Marconcine, M. (2001) Evaluation of Unsteady CFD Methods by their Application to a Transonic Propfan Stage. In: ASME Turbo Expo 2001, pp. 1-12. The American Society of Mechanical Engineers, Atlanta, USA. ASME, International Gas Turbine & Aeroengine Congress & Exhibition, , , 2001-06-04 - 2001-06-07, New Orleans, Louisiane, USA. Volltext nicht online. |
| Schmitt, S. and Nürnberger, D. and Carstens, V. (2003) Evaluation of the Principle of Aerodynamic Superposition in Forced Response Calculations. In: Proceedings of the 10th International Symposium on Unsteady Aerodynamics, Aeroacoustics & Aeroelasticity of Turbomachines. 10th International Symposium on Unsteady Aerodynamics, Aeroacoustics & Aeroelasticity of Turbomachines, Durham (NC), Sept. 7-11 2003. Volltext nicht online. |
| Schmitt, Stefan (2000) Report on Test Case 4 Computations. Project Report. BRPR-CT97-0610. EU. 14 S. Volltext nicht online. |
| Schmitz, G. (1996) Realisierung der Monte-Carlo-Methode zur Strahlungsberechnung auf unstrukturierten Netzen und Anwendung in einer fett-mager gestuften Brennkammer (RQL). Other. 36 S. Volltext nicht online. |
| Schnaubelt, S. (1996) Numerische Simulation des Verhaltens und des Schadstoffausstosses von zivilen Zweistromtriebwerken im Teillastbereich. DLR-Interner Bericht. 325-04-96. 154 S. Volltext nicht online. |
| Schnell, R. (2001) Experimental and Numerical Investigation of Blade Pressure Fluctuations on a CFK-Bladed Counterrotating Propfan. In: ASME Turbo Expo Land, Sea and Air 2001, pp. 1-12. ASME Turbo Expo Land, Sea and Air, New Orleans, Louisiana, USA, June 4-7, 2001. Volltext nicht online. |
| Schnell, R. (2003) Simulation des akustischen Nahfeldes einer Triebwerksgebläsestufe". Seminar für Strömungsmechanik, Berlin, 4.7.2003. Volltext nicht online. |
| Schnell, R. (2004) Investigation of the Acoustic Nearfield of a Transonic-Fanstage by Time-Domain CFD-Calculations with Arbitrary Blade Counts. ASME Turbo-Expo 2004, 7.-14. Juni 2004, Wien/Österreich. Volltext nicht online. |
| Schnell, R. (2004) Numerische Simulation des akustischen Nahfeldes einer Triebwerksgebläsestufe. DLR-Forschungsbericht. 2004-23. Dissertation. 132 S. Volltext nicht online. |
| Schnell, R. (2005) Evaluation of the CFD-Methods elsA and TRACE by their application to Steady and Unsteady Turbine and Compressor Flows. Project Report, DLR-Interner Bericht. 325-15-05. 78 S. Volltext nicht online. |
| Schnell, R. (1993) Kalibrierung von Fuenflochsonden zur dreidimensionalen Messung der Stroemungsgeschwindigkeit in Gasstroemungen und Auswertung von Messungen im Unterschallbereich. Other. Dipl.-Arbeit, FH Köln, März 1993.. 98 S. Volltext nicht online. |
| Schnell, R. (1997) Erstellung eines Programmpaketes zur aerodynamischen Auslegung axialer Verdichterstufen. DLR-Interner Bericht. 325-01-97. 60 S. Volltext nicht online. |
| Schnell, R. (1997) Aerodynamische Auslegung der transsonischen Fanstufe eines 7,3" UHBR-Triebwerksimulators. DLR-Interner Bericht. 325-06-97. 84 S. Volltext nicht online. |
| Schnell, R. and Michel, U. (2003) TurboNoiseCFD Deliverable D1.7: Report per CFD-Code: Assessment of the TRACE-Code for Noise Modelling, Summary of Work. Project Report. D1.7. EU. 21 S. Volltext nicht online. |
| Schnell, R. and Nürnberger, D. and Weber, A. (2004) Zeitgenaue Simulation einer 1.5-stufigen HD-Turbine mit realen Schaufelzahlen. DLR-Interner Bericht. 325-09-04. 25 S. Volltext nicht online. |
| Schnell, R. and Wallscheid, L. (2001) Unsteady Blade Pressure Distributions on a Counterrotating Propfan at On- and Offdesign Conditions. In: 15th International Symposium on Air Breathing Engines, pp. 1-10. AIAA, 1801 Alexander Bell Drive, Suite 500, Reston VA 20191-4344. 15th International Symposium on Air Breathing Engines, ISABE, Bangalore, Indien, 2.-7.9.2001. ISBN 1563475154. Volltext nicht online. |
| Schnell, R. and Weber, A. (2005) CFD-Untersuchungen einer gekühlten Turbinenkonfiguration. Project Report, DLR-Interner Bericht. 325-06-05. 24 S. Volltext nicht online. |
| Schnell, Rainer and Frey, Christian (2021) Acoustic Impact on Fan Flutter Characteristics in Short Aero Engine Intakes. In: AIAA Aviation and Aeronautics Forum and Exposition, AIAA AVIATION Forum 2021. AIAA AVIATION 2021 FORUM, 2021-08-02 - 2021-08-06, Washington DC / Virtual Event. doi: 10.2514/6.2021-2466. ISBN 978-162410610-1. Volltext nicht online. |
| Schnell, Rainer and Julian, Marc and Erik, Goldhahn (2021) Design and Performance of a Low Fan-Pressure-Ratio Propulsion System. In: 32nd Congress of the International Council of the Aeronautical Sciences, ICAS 2021 (1058). ICAS 2021, 2021-09-06 - 2021-09-09, Shanghai / Virtual Event. ISBN 978-393218291-4. Volltext nicht online. |
| Schnell, Rainer and Voges, Melanie and Mönig, Reinhard and Müller, Martin W. and Zscherp, Carsten (2008) Investigation of Blade Tip Interaction with Casing Treatment in a Transonic Compressor - Part 2: Numerical Results. In: ASME-Paper, GT2008-50212. ASME Turbo Expo 2008, 2008-06-09 - 2008-06-13, Berlin, Germany. Volltext nicht frei. |
| Schodl, R. (1998) Laser Two Focus Velocimetry: Two and Three-Dimensional Techniques. VKI Lecture Series, Brüssel, 6-9 April 1998. Volltext nicht online. |
| Schodl, R. (1998) Recent Applications of Three-Dimensional Doppler-Global-Velocimetry in Turbo-Machinery. Engineering Applications of Optical Diagnostic techniques, Northamptonshire, England, 4.11.1998. Volltext nicht online. |
| Schodl, R. (1998) Laser Two Focus Anemometry (3D-L2F) in Three-Dimensional Flows. Optical Techniques for Flow Diagnosis, Grasmere, UK, 27.-30.07.1998. Volltext nicht online. |
| Schodl, R. (1998) First DGV-Application on a DASA Military Aircraft Model in the Low-speed Windtunnel DNW-NWB. DNW Annual Report 1996, DNW. Volltext nicht online. |
| Schodl, R. (1999) Laser-Zwei-Fokus Geschwindigkeitsmessverfahren, Grundlagen und Anwendungen. Strömungsmesstechnik in der industriellen Forschung, Darmstadt, 11.-14. Okt. 1999. Volltext nicht online. |
| Schodl, R. (1999) Planar Quantitative Scattering Techniques for the Analysis of Mixing Processes, Shock Wave Structures and Fluid Density. In: Planar Optical Measurement Methods for Gas Turbine Components. RTO Lecture Series 217, Cranfield, UK, 16-17 Sept. 1999. Volltext nicht online. |
| Schodl, R. (1999) Planar Quantitative Scattering Techniques fot the Analysis of Mixing Processes, Shock Wave Structures and Fluid Density. In: Planar Optical Measurement Methods for Gas Turbine Components. RTO Lecture Series 217, Cleveland, USA, 21-22 Sept, 1999. Volltext nicht online. |
| Schodl, R. (1999) Capabilities Optical Point Measurement Techniques with Respect to Aero Engine Application. In: Planar Optical Measurement Methods for Gas Turbine Components. RTO Lecture Series 217, Cranfield, UK, 16-17 Sept, 1999. Volltext nicht online. |
| Schodl, R. (1999) Capabilities of Optical Point Measurement Techniques with Respect to Aero Engine Application. In: Planar Optical Measurement Methods for Gas Turbine Components. RTO Lecture Series 217, Cleveland, USA, 21-22 Sept., 1999. Volltext nicht online. |
| Schodl, R. (1999) 3D-Doppler-Global Velocimetrie als Messverfahren für Entwicklungsversuche zur Strömungsanalyse. Symposium Aktuelle Entwicklungen in der Strömungsmechanik, Graz, FH Joanneum, 10.02.99,. Volltext nicht online. |
| Schodl, R. (2001) Doppler Global Velocimetry in kryogenen Windkanälen. DGLR-Fachtagung "Messtechnik in kryogenen Windkanälen", TU München, Garching, 27-28 März, 2001. Volltext nicht online. |
| Schodl, R. (2001) User Velocimetry for Combustor Flow Analysis. Gordon Conference: Laser Diagnostics in Combustion, Mount Holycke College, USA, 01-06 July, 2001. Volltext nicht online. |
| Schodl, R. (2001) Laser Velocimetry for Combustor Flow Analysis. GORDON CONFERENCE: Laser Diagnostics in Combustion, Mount Holyoke College (USA) July 1-6, 2001.. Volltext nicht online. |
| Schodl, R. (2002) Capturing the storm within engines. Magazine from the German Aerospace Center, Special Issue:"Innovation is Business", Sept. 2002., Special Issue (103). Volltext nicht online. |
| Schodl, R. (2003) Lasermesstechnik für Srömungen. IHK-Branchenkontakt-Workshop,DLR Köln,24 September 2003. Volltext nicht online. |
| Schodl, R. (1990) Das Laser-Zwei-Fokus-Strömungsgeschwindigkeitsmeßverfahren und seine Anwendung in der Strömungsmaschinenforschung. Seminarreihe "Meßtechnische Anwendungen in der Strömungsmaschinenforschung", 24. Januar 1990, RWTH Aachen. Volltext nicht online. |
| Schodl, R. (1990) Laser Two Focus Velocimetry. Carleton University, Ottawa, Canada, 19 September 1990.. Volltext nicht online. |
| Schodl, R. (1990) Laser Velocimetry. National Research Council, Ottawa, Canada, 18 September 1990.. Volltext nicht online. |
| Schodl, R. (1990) New Development of the Laser Two Focus Technique. Vortrag bei Pratt & Whitney, Montreal, Kanada, am 20. September 1990. Volltext nicht online. |
| Schodl, R. (1991) Laser transit velocimetry. In: "Laser Velocimetry" VKI Lecture Series 1991-8. Volltext nicht online. |
| Schodl, R. (1991) Geschwindigkeitsmessung in Turbomaschinen. Presse-Lasertag, DLR-Stuttgart, 14.05.1991. Volltext nicht online. |
| Schodl, R. (1992) Das Laser-Zwei-Fokus-Stroemungsgeschwindigkeitsmeverfahren- Prinzip, Anwendungsbeispiele, neue Entwicklungen. Seminarvortrag am 08.05.92 am Inst. fuer Fluid- und Thermodynamik, Universitaet-GH-Siegen. Volltext nicht online. |
| Schodl, R. (1994) Einfuehrung in das Laser-Zwei-Fokus-Verfahren. Vortrag:"Laser Anemometry" Universitaet Karlsruhe, 10.-11.Mai 1994. Volltext nicht online. |
| Schodl, R. (1994) Experimentelle Untersuchung zur Expansionsstroemung nach Wasserstoff/Luft-Verbrennung in luftatmenden Hyperschallantrieben. Workshop "Entwicklung und Einsatz von Stroemungsmessverfahren"zum SFB "Grundlagen fuer den Hyperschallflug". Volltext nicht online. |
| Schodl, R. (1994) Application of Laser measurement techniques at TsAGI-Report on the different measurement campaigns. 3rd Working Group meeting "Scramjet Technology". Volltext nicht online. |
| Schodl, R. (1995) Laser-2-Fokus Velocimeter, Grundlagen, Anwendungen und neue Entwicklungen. Workshop "Laser Velocimetrie", Fa. Polytec, Waldbronn, 16/17.03.95. Volltext nicht online. |
| Schodl, R. (1995) Einführung in die Laser-Zwei-Fokus (L2F)-Velocimetrie. "LASER ANEMOMETRY", Universität Karlsruhe (TH), 23./24. Mai 1995. Volltext nicht online. |
| Schodl, R. and Foerster, W. (1991) New development in the laser-2-fokus technique for non-intrusive velocity measurements in gasturbine components. In: Journal de Physique III, Turbomachines Issue, Dec. 1991. Volltext nicht online. |
| Schodl, R. and Foerster, W. (1991) Geschwindigkeitsmessung in Turbomaschinen. DLR-Nachrichten, 63, pp. 12-18. Volltext nicht online. |
| Schodl, R. and Foerster, W. and Beversdorff, M. and Klemmer, T. and Rymenants, E. (1991) Development of 3D-velocimeters based on the laser-2-focus technique. In: Fourth International Conference on Laser Anemometry Advance and Applications. Cleveland Ohio, USA, 05.-09.08.91. Volltext nicht online. |
| Schodl, R. and Förster, W. (1991) Multicolor fiberoptic Laser-Two-Focus velocimeter for three-dimensional flow analysis. AIAA Journal, 29, pp. 1290-1297. Volltext nicht online. |
| Schodl, R. and Förster, W. and Beversdorff, M. (1995) Neue Entwicklungen beim L2F-Verfahren. In: Lasermethoden in der Strömungsmeßtechnik Berichte aus der Lasermeßtechnik. Verlag Shaker, Aachen. 5S.-. Volltext nicht online. |
| Schodl, R. and Förster, W. and Beversdorff, M. (1995) Neue Entwicklungen beim L2F-Verfahren. 4. Fachtagung - GALA "Lasermethoden in der Strömungsmeßtechnik", Rostock, 12.-14.09.1995. Volltext nicht online. |
| Schodl, R. and Förster, W. and Karpinski, G. and Krain, H. and Röhle, I. (2000) 3-Component Doppler Laser-Two-Focus Velocimetry Applied to a Transonic Centrifugal Compressor. 10th International Symp. on Application of Laser Techniques to Fluid Mechanics, Lisbon, Portugal, July 2000, Paper 7-2. Volltext nicht online. |
| Schodl, R. and Förster, W. and Karpinsky, G. and Krain, H. and Röhle, I. (2001) 3-component Doppler Laser-Two-Focus Velocimetry Applied to a Transonic Centrifugal Compressor. In: "Laser Techniques for Fluid Mechanics" Selected papers form the 10th International Symp., Lisbon, Portugal Springer. Volltext nicht online. |
| Schodl, R. and Roehle, I. (1995) Neue Entwicklungen beim Doppler-Global-Verfahren. In: Lasermethoden in der Strömungsmeßtechnik. Verlag Shaker, Aachen 1995. Lasermethoden in der Strömungsmeßtechnik, Rostock, 12.-14. September 1995. Volltext nicht online. |
| Schodl, R. and Röhle, I. (1995) Neue Entwicklungen beim Doppler-Global-Verfahren. 4. Fachtagung - GALA "Lasermethoden in der Strömungsmeßtechnik", Rostock, 12.-14.09.1995. Volltext nicht online. |
| Schodl, R. and Röhle, I. (1996) Doppler Global Velocimetry in the Flow of a Swirler. Vortrag im Rahmen NASA-DLR Kooperation Task 12, 6. Juni 1996, NASA Lewis RC, Cleveland, USA. Volltext nicht online. |
| Schodl, R. and Röhle, I. (1996) Doppler-Global-Velocimetry in der Stroemung einer Drallduese. XXVIII Kraftwerkstechnisches Kolloquium, 6. Kolloquium Meßtechnik für Energieanlagen, 29/30. Okt. 1996, Dresden. Volltext nicht online. |
| Schodl, R. and Röhle, I. and Willert, C. and Fischer, M. and Heinze, J. and Laible, C. and Schilling, T. (2002) Doppler Global Velocimetry for the analysis of combustor flow. Aerospace Science and Technology, 6 (7), pp. 481-493. Volltext nicht online. |
| Schodl, R. and Willert, C. and Roehle, I. and Heinze, J. and Foerster, W. and Fischer, M. and Beversdorff, M. (2002) Optical Diagnostic Techniques in Turbomachinery. 22nd AIAA Aerodynamic Measurement Technology and Ground Testing Conference, St. Louis, Missouri, USA, June 24-27, 2002.. Volltext nicht online. |
| Schodl, R. and Willert, C. and Röhle, I. and Beversdorff, M. and Blümcke, E.W. (2000) Flächige Strömungsgeschwindigkeitsmessung in Motorkomponenten mit der Doppler Global Velocimetrie. Optisches Indizieren - Verbrennungsentwicklung für Otto-Dieselmotoren, Esse, Haus der Technik, 26. Sept. 2000. Volltext nicht online. |
| Schodl, Richard (2005) Doppler-L2F zur 3-Komponenten-Geschwindigkeitsmessung in Turbomaschinen. Expertenkreis Messtechnik,München,25/26 Januar 2005. Volltext nicht online. |
| Schodl, Richard (2005) Laser transit velocimetry. In: Springer Handbook of Experimental Fluid Mechanics Springer Verlag. 3.3.4. ISBN 978-3-540-25141-5. Volltext nicht online. |
| Schreiber, H. A. (1990) Verdichtungsstoesse und Stossgrenzschicht-Wechselwirkung in transsonischen und supersonischen Verdichtungsgittern. Seminarvortrag am Institut fuer Stroemungslehre und Stroemungsmaschin en der Universitaet Karlsruhe, 18. Januar 1990. Volltext nicht online. |
| Schreiber, H. A. (1990) Entwurfsgrundlagen fuer transsonische und supersonische Verzoegerungsgitter. Kolloquium Energietechnik an der Ruhr-Universitaet Bochum, 7. Februar 1990.. Volltext nicht online. |
| Schreiber, H. A. (1990) Starke Stoß-Grenzschicht-Wechselwirkung in einem Überschallverdichtergitter. 7. DGLR-Fachsymposium "Strömungen mit Ablösung" (STAB) in Aachen, 7.-9. November 1990. Volltext nicht online. |
| Schreiber, H. A. (1990) Determination of the Inlet Flow Angle in Tests of Supercritical Cascades. Gas Turbine Establishment (GTE) in Jiangjou, PR China, 16 October 199 0. Volltext nicht online. |
| Schreiber, H. A. (1990) Design of a Transonic Compressor Cascade and Study of Shock-Wave/Boundary Layer Interaction. 1) Institute of Thermophysics, Academia Sinica, Bejing, PR China, 10 October 1990; 2) Gas Turbine Establishment (GTE), Jiangyon, PR Chi na, 17 October 1990. Volltext nicht online. |
| Schreiber, H. A. and Fuchs, R. (1994) Entwicklung einer Entwurfsmethode fuer transsonische Axialverdichtergitter. Posterbeitrag TURBOTECH AK-Sitzung, Köln 10.11.94. Volltext nicht online. |
| Schreiber, H. A. and Steinert, W. (2004) Experimental Investigation of Two Outlet Guide Vane Cascades - Effect of Free-Stream Turbulence on OGV-BASE and OGV-ES and Endwall Performance of the OGV-ES Cascade Part I: Effect of Free-Stream Turbulence. Project Report, DLR-Interner Bericht. DLR IB 325 - 06 -04-1. Volltext nicht online. |
| Schreiber, H. A. and Steinert, W. (2003) Transsonische Profile für eine Frontstufe - Siemens TGG-101 und TGG-104 - Numerische und experimentelle Untersuchungen bei M1 = 0.8 - 1.12. Project Report, DLR-Interner Bericht. IB 325 - 10 - 03. 114 S. Volltext nicht online. |
| Schreiber, H. A. and Steinert, W. (2002) Experimental Investigation of Two Exit Guide Vane Cascades Optimized for Operation at Low Reynolds Numbers - ES-OGV-10 and OGV-MOGA-138. Project Report, DLR-Interner Bericht. DLR IB - 325-03-02. 425 S. Volltext nicht online. |
| Schreiber, H. A. and Steinert, W. (2004) Experimental Investigation of Two Outlet Guide Vane Cascades - Effect Of Free-Stream Turbulence on OGV-BASE and OGV-ES and Enwall Performance of the OGV-ES Cascade, Part II: End-wall Performance of Outlet Guide Vane. Project Report, DLR-Interner Bericht. DLR IB-325-06-04 Part II. 75 S. Volltext nicht online. |
| Schreiber, H. A. and Steinert, W. and Küsters, B. (2002) Effects of Reynolds Number and Free-Stream Turbulence on Boundary Layer Transition in a Compressor Cascade - 2000 Heat Transfer Commitee Best Paper. ASME Journal of Turbomachinery, Vol. 124, Janurary 2002, pp. 1-9. Volltext nicht online. |
| Schreiber, H. A. and Steinert, W. and Sonoda, T. and Arima, T. (2004) Advanced High-Turning Compressor Airfoils for Low Reynolds Number Condition - Part II: Experimental and Numerical Analysis. ASME Journal of Turbomachinery, Vol. 126, October 2004, pp. 482-492. Volltext nicht online. |
| Schreiber, H. A. and Steinert, W. and Sonoda, T. and Arima, T. (2003) Advanced High-Turning Compressor Airfoils for Low Reynolds Number Condition - Part II: Experimental and Numerical Analysis. In: ASME Turbo Expo 2003, Atlanta, June 16-19. International Gasd Turbine and Aero Engine Congress, Atlanta, June 16-19, 2003. Volltext nicht online. |
| Schreiber, H.-A. (1999) Strömung in transsonischen und supersonischen Verdichterbeschaufelungen. Seminar Thermische Energietechnik, Universität Kassel, 24. 06.1999. Volltext nicht online. |
| Schreiber, H.-A. (1999) Development of Advanced Compressor Airfoils for Heavy-Duty Gas Turbines. Part II: Experimental and Theoretical Analysis. ASME Gas Turbine and Aeroengine Technical Congress, Indianapolis, June 7-10, 1999. Volltext nicht online. |
| Schreiber, H.-A. (1991) Experimentelle Untersuchungen an zwei Überschall-Verdichtergittern für den HYPER-CRISP Rotor 2 Rotormittelschnitt CR-52-1, Gehäuseschnitt CR52-2. DLR-Interner Bericht. 325-06-91. 137 S. Volltext nicht online. |
| Schreiber, H.-A. (1991) Shock Losses in Compressor Cascade. Vortrag am Aero Gas Turbine Research Institute (AGTRI) in Jiangyou Sichuan, China, 20.11.91. Volltext nicht online. |
| Schreiber, H.-A. (1991) Design, theoretical, and experimental analysis of a supercritical compressor cascade. Vortrag am Aero Gas Turbine Research Institute (AGTRI) in Jiangyou Sichuan, China, 15.11.91. Volltext nicht online. |
| Schreiber, H.-A. (1991) Starke Stoß-Grenzschicht-Wechselwirkung in einem Überschall-Verdichtergitter. Other. 90-06. DGLR, Bonn. Volltext nicht online. |
| Schreiber, H.-A. (1995) Shock-Wave Turbulent Boundary Layer Interaction in a Highly Loaded Transonic Fan Blade Cascade. 85th AGARD-PEP Symposium on "Loss Mechanisms and Unsteady Flows in Turbomachines", May 8-12, 1995, Derby, UK, paper No. 17. Volltext nicht online. |
| Schreiber, H.-A. and Küsters, B. and Steinert, W. (1998) Experimentelle und numerische Untersuchung des Gasturbinen-Verdichtergitters KWU-HPA-32/093. DLR-Interner Bericht. 325-5-98. Volltext nicht online. |
| Schreiber, H.-A. and Küsters, B. and Steinert, W. (1998) Experimentelle und numerische Untersuchung des Gasturbinen-Verdichtergitters KWU HPA-16/050. DLR-Interner Bericht. 325-07-98. Volltext nicht online. |
| Schreiber, H.-A. and Starken, H. (1991) An investigation of a strong shock-wave turbulent boundary layer interaction in a supersonic compressor cascade. presented at the International Gas Turbine and Aeroengine Congress, Orlande (USA), 03.-06.06.91. Volltext nicht online. |
| Schreiber, H.-A. and Steinert, W. and Küsters, B. (1998) Untersuchungen zum Einfluß der Re-Zahl und des Turbulenzgrades auf die Grenzschichttransitition im Verdichtergitter. DLR-Interner Bericht. 325-08-98. Volltext nicht online. |
| Schreiber, H.-A. and Steinert, W. and Küsters, B. (2000) Effects of Reynolds Number and free-stream Turbulence on Boundary Layer Transition in a Compressor Cascade. International Gas Turbine and Aeroengine Technical Congress, München, Germany, 8.-11. May, 2000. Volltext nicht online. |
| Schreiber, H.A. (2000) Flows in 2- and 3-dimensional Transonic Compressor Cascades. NAL-DLR Workshop on Experimental Fluid Mechanics and Turbomachinery, Bangalore, India, 10.-12. Jan. 2000. Volltext nicht online. |
| Schreiber, H.A. (2000) Design Considerations for Compressor Blade Sections. NAL-DLR Workshop on Experimental Fluid Mechanics and Turbomachinery, Bangalore, India, 10.-12. Jan. 2000. Volltext nicht online. |
| Schreiber, H.A. (2000) Turbomachinery Research-DLR Cologne. NAL-DLR Workshop on Experimental Fluid Mechanics and Turbomachinery, Bangalore, India,10.-12. Jan. 2000. Volltext nicht online. |
| Schreiber, H.A. (2000) Verdichterprofile für transsonische Strömungen - Status. Vortrag bei Siemens Power Generation, Mülheim/Ruhr, 12.12.2000. Volltext nicht online. |
| Schreiber, H.A. (1993) Transsonische Stroemungen in Verdichtergittern. Kolloquium Institut f. Antriebstechnik, DLR in Koeln-Porz, 20.01.93. Volltext nicht online. |
| Schreiber, H.A. (1993) Untersuchung der turbulenten Stoss-Grenzschicht-Wechselwirkung in einem Ueberschallverdichtergitter mit Abloesung. Vortrag 6. STAB Workshop 10.-12.Nov.93 in Goettingen. Volltext nicht online. |
| Schreiber, H.A. (1994) Verdichtergitter mit 'pre-compression' Profilierung. Vortrag MTU-Muenchen, 08.06.1994. Volltext nicht online. |
| Schreiber, H.A. (1994) Stroemung in hochbelasteten Ueberschall-Verdichtergittern. Kolloquium Energietechnik, 21.12.94, Ruhr-Universitaet Bochum. Volltext nicht online. |
| Schreiber, H.A. (1995) Forschungsarbeiten auf dem Gebiet der transsonischen Verdichterbeschaufelung. BMW Rolls-Royce, Dahlewitz bei Berlin, 29.05.1995. Volltext nicht online. |
| Schreiber, H.A. (1995) Transonic Shock Wave Boundary Layer Interaction in Compressor Cascades. DLR-ONERA Workshop, ONERA-CERT, Toulouse, 14.11.1995. Volltext nicht online. |
| Schreiber, H.A. (1996) Experimentelle Untersuchung der KWU-Verdichterprofile HPA 28/08 und HPA 17/06. Vortrag bei Siemens AG / KWU in Mülheim/Ruhr, 2. Juli 1996. Volltext nicht online. |
| Schreiber, H.A. (1997) Recent activities in transonic compressor cascade research. Besuch von Karman Institut, DLR Koeln, 17.06.97. Volltext nicht online. |
| Schreiber, H.A. and Fuchs, R. (1993) Entwurfsgrundlagen fuer transsonische Axialverdichtergitter. Posterpraesentation zur Arbeitskreissitzung AG-Turbo-TURBOTECH Koeln 15.-16.03.1993. Volltext nicht online. |
| Schreiber, H.A. and Fuchs, R. and Weber, A. and Steinert, W. (2001) Räumliche Strömung in transsonischen Verdichtergittern sehr hoher Belastung. In: Siebtes Statusseminar, Verbundprojekt Hochtemperatur Gasturbine,Verbundprojekt CO2-armes Kraftwerk - 500 MW auf einer Welle, 2-1-2-15. 7. Statusseminar der AG TURBO, Verbundprojekt der Hochtemperatur-Gasturbine, Köln, 7.-8.12.2000. Volltext nicht online. |
| Schreiber, H.A. and Herzke, J. (1993) Dreidimensionale Stoss-Wandgrenzschicht-Interferenz im Eintrittsbereich von transsonischen Verdichterschaufeln. DGLR-Fachausschussitzung "Dreidimensionale reibungsbehaftete Stroemung in Turbomaschinen, 29./30.04.93 in Stuttgart. Volltext nicht online. |
| Schreiber, H.A. and Kuesters, B. (1997) Numerical Simulation of Compressor Cascade Flow with Strong Shock-Wave Boundary Layer Interaction. Joint Propulsion Conference and Exhibit, Seattle, WA, 6-9, July, 1997. Volltext nicht online. |
| Schreiber, H.A. and Küsters, B. (1997) Numerische Simulation der Strömung in einem supersonischen Verdichtergitter mit starker Stoß-Grenzschicht-Interferenz. 8. STAB Workshop, Göttingen, 11.-12. Nov. 1997. Volltext nicht online. |
| Schreiber, H.A. and Küsters, B. and Steinert, W. (1998) Experimentelle und numerische Untersuchung des Gasturbinengitters KWU-HPA-26/074. Project Report, DLR-Interner Bericht. 325-05-98. Volltext nicht online. |
| Schreiber, H.A. and Starken, H. and Steinert, W. (1993) Transonic and Supersonic Cascades; in AGARDOgraph 328 on Advanced Methods for Cascade Testing. In: AGARDograph AGARDOgraph Advanced Methods for Cascade Testingascade Testing, 328 . pp. 35-72. Volltext nicht online. |
| Schreiber, H.A. and Steinert, W. (2001) Experimental Investigation of the Exit Guid Vane Cascade OGV-CDA at Different Reynolds- and Mach numbers. DLR-Interner Bericht. 325-04-01. 205 S. Volltext nicht online. |
| Schreiber, H.A. and Steinert, W. (2001) Untersuchungen zum Einfluss der Profildruckverteilung und der Vorderkantengeometrie auf die aerodynamischen Beiwerte von Verdichtergittern. Project Report, DLR-Interner Bericht. Datenbericht. Volltext nicht online. |
| Schreiber, H.A. and Steinert, W. and Kuesters, B. (1997) Zum Einfluss der Re-Zahl und des Turbulenzgrades auf die Grenzschichttransition. Statusseminar DLR-KWU Kooperation, 19.12.1997, Muelheim/Ruhr. Volltext nicht online. |
| Schreiber, H.A. and Steinert, W. and Kuesters, B. (1997) Untersuchung von vier Unterschall-Verdichterprofilen aus der HPA-Systematik. Statusseminar DLR-KWU Kooperation, 19.12.1997, Muelheim/Ruhr. Volltext nicht online. |
| Schreiber, H.A. and Weber, A. and Fuchs, R. and Steinert, W. (2001) 3D Transonic Flow in a Compressor Cascade with Shock-Induced Corner Stall. The 46th ASME International Gas Turbine & Aeroengine Technical Congress, New Orleans, USA, June 4-7, 2001. Volltext nicht online. |
| Schreiber, H.A. and Starken, H. (1992) An Investigation of a Strong Shock-Wave Turbulent Boundary Layer Interaction in a Supersonic Compressor Cascade. Transaction of the ASME, Journal of Turbomachinery July 1992, Vol.14, pp.494-503, pp. 949-503. Volltext nicht online. |
| Schreiber, H.A. and Steinert, W. and Starken, H. (1992) Investigation of a Cascade with Controlled Duffusion Airfoils Designed for an Inlet Mach Number of 0.92. DLR-Interner Bericht. 325-06-92. SM-AT. 102 S. Volltext nicht online. |
| Schröder, Andreas and Agocs, Janos and Geisler, Reinhard and Heider, André and Politz, Christina and Boden, Fritz and Konrath, Robert and Roosenboom, Eric and Willert, Christian and Kompenhans, Jürgen and Wieneke, Bernd and Michaelis, Dirk and Elsinga, Gerrit E. and Scarano, Fulvio and Poelma, Christian and Westerweel, Jerry (2009) Developments for Industrial PIV. Symposium 25 Years of PIV in aerodynamics, 2009-09-23 - 2009-09-25, Göttingen, Germany. Volltext nicht online. |
| Schröder, Andreas and Agocs, Janos and Geisler, Reinhard and Heider, André and Politz, Christina and Boden, Fritz and Konrath, Robert and Roosenboom, Eric and Willert, Christian and Kompenhans, Jürgen and Wieneke, Bernhard and Michaelis, Dirk and Elsinga, Gerrit and Scarano, Fulvio and Poelma, Christian and Westerweel, Jerry (2010) Developments of PIV in Aerodynamics. Internationale Physik Olympiade , 2010-01-23 - 2010-01-29, Göttingen, Germany. Volltext nicht online. |
| Schröder, Andreas and Geisler, Reinhard and Agocs, Janos and Heider, André and Roosenboom, Eric and Herr, Michaela and Konrath, Robert and Willert, Christian and Kompenhans, Jürgen and Wieneke, Bernhard and Dierksheide, Uwe and Elsinga, Gerit E. and Scarano, Fulvio and Poelma, Christian (2009) Particle Image Velocimetry (PIV) - Grundlagen der Messtechnik und Anwendungen in der Aerodynamikforschung. Seminar für Strömungstechnik, 2009-06-16, München, Deutschland. Volltext nicht online. |
| Schröder, Andreas and Geisler, Reinhard and Agocs, Janos and Heider, André and Roosenboom, Eric and Herr, Michaela and Konrath, Robert and Willert, Christian and Kompenhans, Jürgen and Wieneke, Bernhard and Dierksheide, Uwe and Elsinga, Gerit E. and Scarano, Fulvio and Poelma, Christian (2009) Particle Image Velocimetry (PIV) - Grundlagen der Messtechnik und Anwendungen in der Aerodynamikforschung. Optische Messtechnik, 2009-06-22, Darmstadt, Deutschland. Volltext nicht online. |
| Schröder, Andreas and Geisler, Reinhard and Agocs, Janos and Heider, André and Roosenboom, Eric and Herr, Michaela and Konrath, Robert and Willert, Christian and Kompenhans, Jürgen and Wieneke, Bernhard and Dierksheide, Uwe and Elsinga, Gerrit and Scarano, Fulvio and Poelma, Christian (2009) Applications of Particle Image Velocimetry to industrial aerodynamic research. JMBC Course Particle Image Velocimetry, 2009-10-26 - 2009-10-30, Delft, The Netherlands. Volltext nicht online. |
| Schubert, S. and Neumann, S. O. and Weigand, B. and Elfert, M. and Jarius, M. and Hoevel, H. (2002) Optimierung von rotierenden Multipass-Kühlsystemen. 8. Statusseminar AG-TURBO: Verbundprojekt für ein CO2-armes Kraftwerk "500 MW auf einer Welle", Köln, 5./6. Dez, 2002. Volltext nicht online. |
| Schubert, S. and Neumann, S.O. and Jarius, M. and Elfert, M. and Weigand, B. (2003) Investigation of flow phenomena and heat transfer performance of a ribbed two-pass cooling channel with turbine typical cross sections. In: Proceedings. 16th Intern.Symp. on Air Breathing Engines,Aug.31-Sept.5,2003,Cleveland,Ohio,USA. Volltext nicht online. |
| Schuchardt, Bianca Isabella and Becker, Dennis and Becker, Richard-Gregor and End, Albert and Gerz, Thomas and Meller, Frank and Metz, Isabel Carole and Niklaß, Malte and Pak, Henry and Shiva Prakasha, Prajwal and Schier-Morgenthal, Sebastian and Schweiger, Karolin and Sülberg, Jean Daniel and Swaid, Majed and Torens, Christoph and Zhu, Chen (2021) Urban Air Mobility Research at the DLR German Aerospace Center - Getting the HorizonUAM Project Started. In: AIAA Aviation and Aeronautics Forum and Exposition, AIAA AVIATION Forum 2021. AIAA Aviation Forum, 2021-08-02 - 2021-08-06, virtual. doi: 10.2514/6.2021-3197. ISBN 978-162410610-1. |
| Schuchardt, Bianca Isabella and End, Albert and Meller, Frank and Pak, Henry and Schweiger, Karolin and Torens, Christoph (2023) HorizonUAM Project Highlights. In: 3rd UAM Symposium. 3rd UAM Symposium, 2023-07-04 - 2023-07-05, Cochstedt, Germany. Volltext nicht online. |
| Schuchardt, Bianca Isabella and End, Albert and Meller, Frank and Pak, Henry and Schweiger, Karolin and Torens, Christoph (2023) HorizonUAM Projektvorstellung. In: 3rd UAM Symposium. 3rd UAM Symposium, 2023-07-04 - 2023-07-05, Cochstedt, Germany. Volltext nicht frei. |
| Schuchardt, Bianca Isabella and Pak, Henry and Meller, Frank and Torens, Christoph and End, Albert (2024) The Future of Urban Air Mobility. Project Report. DLR. doi: 10.60575/aca8-3c26. |
| Schuchardt, Bianca Isabella and Pak, Henry and Meller, Frank and Torens, Christoph and End, Albert (2024) Die Zukunft der städtischen Luftmobilität. Project Report. DLR. doi: 10.60575/kebq-3m69. |
| Schuetz, H. and Eickhoff, H. and Theisen, P. and Griebel, P. and Koopman, J. (1997) Analysis of the Mixing Zone of an Air Staged Combustor. In: Proc. XIII ISABE 1997. XIII ISABE, Chattanooga, USA, 1997. Volltext nicht online. |
| Schuetz, H. and Muehleck, P. (1993) Numerical Study of the Reactive Flow in a H2-Fueled Ramjet. In: Procs.: Sciences et Defense 1993, Vouvelles Acancees Scienfifiques at Techniques. Entretiens Science et Defense 1993, Paris 11.-12. Mai 1993. Volltext nicht online. |
| Schulze, R. (1993) Theoretical Examination of the Behaviour of Seed Particles in Turbulent Flow Fields with Strong Accelerations. Diploma. Volltext nicht online. |
| Schwarz, C. and Brandt, H. and Fottner, L. and Stockhausen, G. and Beversdorff, M. and Schodl, R. (2003) Doppler Global Velocimetry Messungen im Verteilerkanal eines typischen Abblase-Luftsystem für mehrstufige Axialverdichter. In: Lasermethoden in der Strömungsmesstechnik, 32.1-32.9. Lasermethoden in der Strömungsmesstechnik, Braunschweig, 9-11.9.2003. ISBN 3-00-011903-5. Volltext nicht online. |
| Schäfer, Philipp and Cierpka, Christian and Rehder, Hans-Jürgen and Röhle, Ingo (2011) Wavelet analysis of vortical structures in turbomachinery applied to PIV data. ASME Turbo Expo 2011, 2011-06-06 - 2011-06-10, Vancouver, Kanada. Volltext nicht online. |
| Schäfer, Philipp and Giess, P.-A. and Finzel, Conrad and Hofmann, Willy (2014) Verbesserung des Druckrückgewinns in axialen Kraftwerksdiffusoren. In: Tagungsband AGTurbo Statusseminar. AGTurbo Programmleitung. AGTurbo Statusseminar, 2014-12-08 - 2014-12-09, DLR Köln, Deutschland. Volltext nicht online. |
| Schäfer, Philipp and Gieß, P.-A. and Finzel, Conrad and Hofmann, Willy (2014) Verbesserung des Druckrückgewinns in axialen Kraftwerksdiffusoren. Project Report. Volltext nicht online. |
| Schöffler, Robin (2019) NUMERISCHE UNTERSUCHUNG DES WÄRMEÜBERGANGS UND DES STRÖMUNGSFELDES EINER GENERISCHEN FILMKÜHLUNGSKONFIGURATION. Master's, Ruhr Universität Bochum / DLR Institut für Antriebstechnik. Volltext nicht frei. |
| Schönweitz, Dirk and Becker, Richard-Gregor and Schnell, Rainer and Schroll, Michael and Ebel, Paul-Benjamin (2016) Aerodynamic Performance Characteristics of the Installe V2527 Fan at Ground Operation. 54th AIAA Aerospace Sciences Meeting, 2016-01-04 - 2016-01-08, San Diego, USA. doi: 10.2514/6.2016-0111. Volltext nicht online. |
| Seelhorst, U. and Lehmann, B. and Weiland, M. and Sauerland, K.H. and Bütefisch, K. A. (1995) Strömunsfeldmessungen im Klappensystem einer Hochauftriebskonfiguration mittels 3-Komponenten-Laser-Doppler-Anemometer. DLR-Interner Bericht. 223 - 94 C 57. 22 S. Volltext nicht online. |
| Seifert, M. and Heinze, J. and Schodl, R. (2003) Bau einer Kalibriervorrichtung für Absorptionsfilterkennlinien von Jodzellen für die Doppler Global Velocimetry. In: Lasermethoden in der Strömungsmeßtechnik, 11, 33.1-33.6. GALA, 2003-09, Rostock. ISBN 3-00-011903-5. Volltext nicht online. |
| Semidetnov, N. (1995) Theoretical and experimental study of time-of-flight anemometer as particle sizing in instrument. DLR-Interner Bericht. 325-04-95. 114 S. Volltext nicht online. |
| Seum, Stefan and Heinrichs, Matthias and Henning, Arne and Hepting, Michael and Keimel, Hermann and Matthias, Volker and Müller, Stephan and Neumann, Thorsten and Özdemir, Enver Doruk and Plohr, Martin and Pregger, Thomas and Sanok, Sandra and Sausen, Robert and Seebach, Oliver and Vogel, Bernhard and Winkler, Christian (2015) The DLR VEU-Project Transport and the Environment - building competency for a sustainable mobility future. 4th Conference on Transport, Atmosphere and Climate, TAC-4, 2015-06-22 - 2015-06-25, Bad Kohlgrub, Deutschland. Volltext nicht online. |
| Siggel, Martin and Reitenbach, Stanislaus and Banovic, Mladen and Pahs, Andreas (2024) Closing the Gap between Data Model driven Geometry Generation and HiFi CAD for Automatized and Consistent Design Analysis. In: AIAA SciTech 2024 Forum. AIAA SCITECH 2024 Forum, 2024-01-08 - 2024-01-12, Orlando, FL, USA. doi: 10.2514/6.2024-2897. ISBN 978-162410711-5. Volltext nicht frei. |
| Silberhorn, Daniel (2024) EXACT Final Report. Project Report. (Submitted) Volltext nicht online. |
| Silberhorn, Daniel and Dahlmann, Katrin and Görtz, Alexander and Linke, Florian and Zanger, Jan and Rauch, Bastian and Methling, Torsten and Janzer, Corina and Hartmann, Johannes (2022) Climate Impact Reduction Potentials of Synthetic Kerosene and Green Hydrogen Powered Mid-Range Aircraft Concepts. Applied Sciences, 12 (12), p. 5950. Multidisciplinary Digital Publishing Institute (MDPI). doi: 10.3390/app12125950. ISSN 2076-3417. |
| Siller, Henri (2024) The 10th Berlin Beamforming Conference. 10th Berlin Beamforming Conference, 2024-06-10 - 2024-06-11, Berlin. doi: 10.5281/zenodo.14925814. Volltext nicht frei. |
| Sippel, M. and Sodomann, M. and Deidewig, F. (1995) Evaluation of High Speed Turbojet/Turbofan Engine Concepts on the Performance of the DSL STS-Booster-Stage. In: AIAA-paper: 95-2750. American Inst. of Aeronautics and Astronautics Washington D.C.. 31st Joint Propulsion Conference, San Diego, CA, USA. Volltext nicht online. |
| Slemr, F. and Giehl, H. and Habram, M. and Slemr, J. and Schlager, H. and Schulte, P. and Haschberger, Peter and Lindermeir, Erwin and Döpelheuer, A. and Plohr, M. (2001) In-Flight Measurement of Aircraft CO and Nonmethane Hydrocarbon Emission Indices. Journal of Geophysical Research, 106 (D7), pp. 7485-7494. Volltext nicht online. |
| Sonoda, T. and Arima, T. and Olhofer, M. and Sendhoff, B. and Kost, F. and Gieß, P.-A. (2004) A Study of Advanced High Loaded Transonic Turbine Airfoils. In: Poceedings of ASME Turbo Expo 2004 Power for Land, Sea and Air, GT2004-53773. ASME Turbo Expo 2004, Vienna, Austria, 14-17 June 2004, Austria. Volltext nicht online. |
| Sonoda, T. and Yamaguchi, Y. and Arima, T. and Olhofer, M. and Sendhoff, B. and Schreiber, H. A. (2004) Advanced High Turning Compressor Airfoils for Low Reynolds Number Condition - Part I: Design and Optimization. ASME Journal of Turbomachinery, Vol. 126, July 2004, pp. 350-359. Volltext nicht online. |
| Sonoda, T. and Yamaguchi, Y. and Arima,, and Olhofer, M. and Sendhoff, B. and Schreiber, H. A. (2003) Advanced High Turning Compressor Airfoils for Low Reynolds Number Conditrion - Part I: Design and Optimization. In: ASME Turbo Expo 2003. International Gas Turbine and Aero Engine Congress, Atlanta, GA, June 16-19, 2003. Volltext nicht online. |
| Spinelli, Gregorio Gerardo and Masilamani, Kannan and Horstmann, Tobias and Soni, Malav Mukesh and Klimach, Harald and Stück, Arthur and Roller, Sabine (2022) HPC Performance study of different collision models using the Lattice Boltzmann solver Musubi. 18th International Conference on Mesoscopic Methods for Engineering and Science, 2022-06-29 - 2022-07-01, La Rochelle, France. |
| Spinner, Sebastian and Keller, Dennis and Schnell, Rainer and Trost, Marco (2020) A Blade Element Theory Based Actuator Disk Methodology for Modeling of Fan Engines in RANS Simulations. In: AIAA Aviation 2020 Forum, pp. 1-19. AIAA Aviation 2020 Forum, 2020-06-15 - 2020-06-19, Reno, Nevada, USA. doi: 10.2514/6.2020-2749. ISBN 978-162410598-2. |
| Stanislas, Michel and Hinsch, KLaus and Westerweel, Jerry and Willert, CHristian and Ehrenfried, KLaus and Kompenhans, Jürgen and Schröder, Andreas and Raffel, Markus and Kähler, Christian and Bao, Feng and Klinge, Falk and Konrath, Robert and Sammler, Bernd and Stasicki, Boleslaw and Agocs, Janos and Frahnert, Holger and Vollmers, Heinrich and Christou, K. and Mattner, Hartmut and Micknaus, Ilka and Rosenstock, Catrin and Henze, Doris (2004) Application of Particle Image Velocimetry -Theory and Practice -, Course Notes. Volltext nicht online. |
| Stanislas, Michel and Hinsch, Klaus and Poelma, Christian and Willert, Christian and Kähler, Christian and Ehrenfried, Klaus and Raffel, Markus and Geisler, Reinhard and Kompenhans, Jürgen and Schröder, Andreas and Stasicki, Boleslaw and Agocs, Janos and Boden, Fritz and Frahnert, Holger and Heider, André and Henning, Arne and Kirmse, Tania and Mattner, Hartmut and Otter, Dirk and Micknaus, Ilka and Rosenstock, Catrin and Micknaus, Jennifer and Mattner, Alexandra (2007) Application of Particle Image Velocimetry -Theory and Practice- Course Notes. Course Notes, Ordner. Volltext nicht online. |
| Stanislas, Michel and Hinsch, Klaus and Westerweel, Jerry and Kähler, Christian and Raffel, Markus and Poelma, Christian and Willert, Christian and Ehrenfried, Klaus and Geisler, Reinhard and Stasicki, Boleslaw and Kompenhans, Jürgen and Schröder, Andreas and Schanz, Daniel and Gesemann, Sebastian and Agocs, Janos and Roosenboom, Eric and Boden, Fritz and Kirmse, Tania and Krebs, Ingo and Mattner, Hartmut and Otter, Dirk and Zani, Xhevahire and Rosenstock, Catrin and Micknaus, Ilka (2010) Application of Particle Image Velocimetry -Theory and Practice- Course Notes. Course Notes, Ordner. Volltext nicht online. |
| Stanislas, Michel and Hinsch, Klaus and Westerweel, Jerry and Kähler, Christian and Raffel, Markus and Poelma, Christian and Willert, Christian and Ehrenfried, Klaus and Geisler, Reinhard and Stasicki, Boleslaw and Kompenhans, Jürgen and Schröder, Andreas and Schanz, Daniel and Gesemann, Sebastian and Agocs, Janos and Roosenboom, Eric and Kirmse, Tania and Krebs, Ingo and Mattner, Hartmut and Otter, Dirk and Rosenstock, Catrin and Micknaus, Ilka (2011) Application of Particle Image Velocimetry -Theory and Practice- Course Notes. Course Notes, Ordner. Volltext nicht online. |
| Stanislas, Michel and Hinsch, Klaus and Westerweel, Jerry and Kähler, Christian and Raffel, Markus and Poelma, Christian and Willert, Christian and Ehrenfried, Klaus and Geisler, Reinhard and Stasicki, Boleslaw and Koop, Lars and Schröder, Andreas and Schanz, Daniel and Gesemann, Sebastian and Agocs, Janos and Roosenboom, Eric and Kompenhans, Jürgen and Mattner, Hartmut and Otter, Dirk and Rosenstock, Catrin and Micknaus, Ilka and Wrede, Björn (2012) Application of Particle Image Velocimetry -Theory and Practice- Course Notes. Course Notes, Ordner. Volltext nicht online. |
| Stanislas, Michel and Hinsch, Klaus and Westerweel, Jerry and Kähler, Christian and Raffel, Markus and Poelma, Christian and Willert, Christian and Ehrenfried, Klaus and Geisler, Reinhard and Kompenhans, Jürgen and Schröder, Andreas and Stasicki, Boleslaw and Schanz, Daniel and Agocs, Janos and Roosenboom, Eric and Boden, Fritz and Kirmse, Tania and Zani, Xhevahire and Mattner, Hartmut and Otter, Dirk and Aue, Reneé and Micknaus, Ilka and Rosenstock, Catrin and Micknaus, Jennifer (2009) Application of Particle Image Velocimetry -Theory and Practice- Course Notes. Course Notes, Ordner. Volltext nicht online. |
| Stanislas, Michel and Hinsch, Klaus and Westerweel, Jerry and Poelma, Christian and Willert, Christian and Kähler, Christian and Ehrenfried, Klaus and Raffel, Markus and Geisler, Reinhard and Kompenhans, Jürgen and Schröder, Andreas and Stasicki, Boleslaw and Agocs, Janos and Boden, Fritz and Heider, André and Henning, Arne and Kirmse, Tania and Mattner, Hartmut and Otter, Dirk and Micknaus, Ilka and Rosenstock, Catrin and Micknaus, Jennifer (2008) Application of Particle Image Velocimetry -Theory and Practice- Course Notes. Course Notes, Ordner. Volltext nicht online. |
| Stanislas, Michel and Hinsch, Klaus and Westerweel, Jerry and Willert, Christian and Kähler, Christian and Ehrenfried, Klaus and Raffel, Markus and Kompenhans, Jürgen and Schröder, Andreas and Klinge, Falk and Konrath, Robert and Stasicki, Boleslaw and Koop, Lars and Agocs, Janos and Frahnert, Holger and Heider, André and Mattner, Hartmut and Micknaus, Ilka and Rosenstock, Catrin and Mattner, Alexandra (2005) Application of Particle Image Velocimetry -Theory and Practice- Course Notes. Course Notes, Ordner. Volltext nicht online. |
| Stanislas, Michel and Hinsch, Klaus and Westerweel, Jerry and Willert, Christian and Kähler, Christian and Ehrenfried, Klaus and Raffel, Markus and Kompenhans, Jürgen and Schröder, Andreas and Klinge, Falk and Konrath, Robert and Stasicki, Boleslaw and Koop, Lars and Agocs, Janos and Frahnert, Holger and Heider, André and Mattner, Hartmut and Micknaus, Ilka and Rosenstock, Catrin and Mattner, Alexandra (2006) Application of Particle Image Velocimetry -Theory and Practice- Course Notes. Course Notes, Ordner. Volltext nicht online. |
| Starken, H. (1990) Zu- und Abströmung ebener Überschallgitter. Seminar für Strömungslehre und Strömungsmaschinen, Universität Karlsruhe, 11. Januar 1990. Volltext nicht online. |
| Starken, H. (1991) Utilization of Linear Cascade Experiments in Turbomachine Design Development. Third Dynamics of Turbomachinery, Ames Iowa USA, 13.-23.08.91 Iowa State University. Volltext nicht online. |
| Starken, H. (1991) Aufgaben und Ziele der Gitteraerodynamik im Institut für Antriebstechnik. Seminarvortrag, SM-AT, 29.01.91. Volltext nicht online. |
| Starken, H. (1993) Sind Axialverdichter noch zu verbessern? DLR Nachrichten, 1993 (73), pp. 21-26. Volltext nicht online. |
| Starken, H. (1993) Basic Fluid Dynamic Boundary Conditions of Cascade Wind Tunnels. In: AGARDograph 328, "Advanced Methods for Cascade Testing", Editor: C. Hirsch AG-328. pp. 11-12. Volltext nicht online. |
| Starken, H. (1992) Performance of Controlled Diffusion Blades. In: in VKI Lecture Series Monographs 1992-02 on "Axial Flow Compressors". Volltext nicht online. |
| Starken, H. and Jawtusch, V. (1993) An Improved Off-Design Loss Prediction Method for Supercritical Compressor Blades. In: Proceedings 2. ISAIF, Volume 2, pp. 517-523. Society of Czech Mathematicians and Physicists. 2nd Internat. Symp. on Experimental and Computational Aerothermodynamics of Internal Flows, 12.-15. Juli 1993, Prag, Tschech. Rep.. Volltext nicht online. |
| Starken, H. and Steinert, W. (1993) Boundary-Layer Separation and Transition Visualized by Liquid Crystal Costing. In: 11th Symp. on "Measuring Techniques for Transonic and Supersonic Flow in Cascades and Turbomachines", Paper No.18, Uni BW Muenchen. Editor: L. Fottner, IB-LAT-WE12-93/05, 1993.. Volltext nicht online. |
| Starken, H. and Steinert, W. (1994) Experimentelle Untersuchung des Propellerprofils P2 bei 6 Reynoldszahlen zwischen 0,2 und 1,6 x 10. DLR-Interner Bericht. 325-11-94. Volltext nicht online. |
| Starken, H. and Steinert, W. (1992) Boundary Layer Separation and Transition Visualized by Liquid Drystal Coating. 11th Symposium on "Measuring Techniques for Transonic and Supersonic Flow in Cascades and Turbomachines" , , 1992-09-14 - 1992-09-15, Muenchen. Volltext nicht online. |
| Starken, Hans (1993) Basic Fluid Dynamic Boundary Conditions of Cascade Wind Tunnels. In: AGARDograph 328, "Advanced Methods for Cascade Testing", Editor: C. Hirsch AG-328. pp. 11-12. Volltext nicht online. |
| Stasicki, Boleslaw and Kompenhans, Jürgen and Willert, Christian (2010) Pulsed High-Power LED Illuminator for the Visualisation and Measurement of Flows. ISFV14 - 14th International Symposium on Flow Visualization, 2010-06-21 - 2010-06-24, Daegu, Korea. Volltext nicht online. |
| Steger, M. and Lemke, O. and Thiele, F. and Ashcroft, G. and Nürnberger, D. and Neise, W. (2006) Active control of fan interaction noise using bluff body induced secondary sources. In: ISMA-Tagung. ISMA International Conference on Noise and Engineering, 2006-09-18 - 2006-09-20, Leuven (Belgien). Volltext nicht online. |
| Steinert, W. (1990) Experimental Determination of the Inlet Flow Angle of Transonic Cascades. 10th Symposium on Measuring Techniques of Transonic Flows in Cascades and Turbomachines, 17-18 September 1990, Brussels. Volltext nicht online. |
| Steinert, W. (1991) Experimental determination of the inlet flow angle of transonic cascade. Proceedings of 10th Symposium VKI, Rhode-Saint-Genese, 17.-18.09.91. Volltext nicht online. |
| Steinert, W. (1994) Experimentelle Untersuchung des Verdichtergitters MAN GHH RAS 92. DLR-Interner Bericht. 325-02-94. 55 S. Volltext nicht online. |
| Steinert, W. (1994) Experimentelle Untersuchung des Verdichtergitters MAN GHH RAS 92. DLR-Interner Bericht. 325-02-94. 55 S. Volltext nicht online. |
| Steinert, W. (1994) Experimentelle Untersuchung des Verdichtergitters MAN GHH LNS 92. DLR-Interner Bericht. 325-03-94. 84 S. Volltext nicht online. |
| Steinert, W. (1995) Methode zur Darstellung von Strömungsablösung und des Grenzschichtumschlages mit Hilfe von Flüssigkristallen. DGLR-Fachausschußsitzung;Flächige Strömungsmeßverfahren; 2./3. März 1995 an der TU Berlin, 1995-03-02 - 1995-03-03, Berlin. Volltext nicht online. |
| Steinert, W. (1995) Methode zur Darstellung von Strömungsablösung und des Grenzschichtumschlages mit Hilfe von Flüssigkristallen. In: Flächige Strömungsmeßverfahren. Institut für Luft- und Raumfahrt - TU Berlin. Proceedings DGLR-Fachausschußtagung;Experimentelle Aerodynamik; 2./3. März 1995, Berlin, 1995-03-02 - 1995-03-03, Berlin. Volltext nicht online. |
| Steinert, W. and Eisenberg, B. and Starken, H. (1991) Design and testing of a controlled diffusion airfoil cascade for industrial axial flow compressor application. ASME Journal of Turbomachinery, Band 4 (Vol. 113), pp. 583-590. Volltext nicht online. |
| Steinert, W. and Eisenberg, B. and Starken, H. (1991) Design and testing of a controlled diffusion airfoil cascade for industrial axial flow compressor application. ASME Journal of Turbomachinery, Band 4 (Vol. 113), pp. 583-590. Volltext nicht online. |
| Steinert, W. and Eisenberg, B. and Starken, H. (1991) Design and testing of a controlled diffusion airfoil cascade for industrial axial flow compressor application, ASME paper 90-GT-140. ASME International Gas Turbine and Aeroengine Congress and Exposition, 1990, Brüssel. Volltext nicht online. |
| Steinert, W. and Fuchs, R. and Starken, H. (1991) Inlet flow angle determination of transonic compressor cascade. 36th ASME International Gas Turbine and Aeroengine Congress and Exposition, Orlando (USA), 03.-06.06.91. Volltext nicht online. |
| Steinert, W. and Fuchs, R. and Starken, H. (1992) Inlet Flow Angle Determination of Transonic Compressor Cascades. Transactions of the ASME, Journal of Turbomachinery, Vol.144, No. 3, July 1992, 3, pp. 487-493. The American Society of Mechnical Engineers, 345E. 47St., NY1007, USA. Volltext nicht online. |
| Steinert, W. and Lohrengel, K. (1995) Experimentelle und theoretische Untersuchungen des Verdichtergitters MAN GHH LE HAMAX2 S1. DLR-Interner Bericht. 325-03-95. 131 S. Volltext nicht online. |
| Steinert, W. and Schreiber, H. and Weber, A. (1996) Experimente am transsonischen Verdichtergitter DLR-TSG-89-5 bei M1= 0.9 und M1= 1.09. DLR-Interner Bericht. 325-10-96. 80 S. Volltext nicht online. |
| Steinert, W. and Schreiber, H.A. (2001) Experimentelle Untersuchungen zum Einfluss der Oberflächenrauhigkeit an Verdichterprofilen des Typs CDA und HPA. Project Report, DLR-Interner Bericht. DLR-Datenbericht 10/01. 300 S. Volltext nicht online. |
| Steinert, W. and Starken, H. (1994) Off-Design Transition and Separation Behaviour of a CDA Cascade. In: ASME-Paper 94-GT-214. The American Society of Mechanical Engineers 345E.47thSt.,NY10017USA. International Gas Turbine and Aeroengine Congress and Exposition ASME, The Hague, Netherlands, June 13-16, 1994, 1994-06-13 - 1994-06-16, Niederlande. Volltext nicht online. |
| Steinert, W. and Starken, H. (1996) Off-Design Transition and Separation Behavior of a CDA-Cascade. The American Society of Mechanical Engineers, 345 East 47th Street,. Volltext nicht online. |
| Steinville, R. (2005) Calibration of a three-hole cylindrical pressure probe in sub- and supersonic flow. DLR-Interner Bericht. 225-2005 A 01. 64 S. Volltext nicht online. |
| Stockhausen, G. and Fischer, M. and Heinze, J. and Müller, M. (2004) Anwendung von DGV in heissen Brennkammern. In: Lasermethoden in der Strömungsmesstechnik, 11.1-11.6. Lasermethoden in der Strömungsmesstechnik, Karlsruhe, 7-9.9.2004. ISBN 3-9805613-1-3. Volltext nicht online. |
| Stockhausen, Guido and Beversdorff, Manfred and Burow, Eike Jens and Heinze, Johannes and Klinner, Joachim and Weiss, Armin and Willert, Christian (2024) Development of an endoscopic, absorption corrected and calibrated OH laser induced fluorescence probe system for high pressure combustion diagnostics. 21st International Symposium on the Application of Laser and Imaging Techniques to Fluid Mechanics, 2024-07-08 - 2024-07-11, Lissabon, Portugal. doi: 10.55037/lxlaser.21st.31. |
| Stollenwerk, Stefan and Nürnberger, Dirk (2009) Deterministic Stress Modelling for Transonic Compressor Flows. In: 8th European Conference on Turbomachinery, Fluid Dynamics and Thermodynamics, pp. 267-276. Verlag der Technischen Universität Graz. ETC 2009, 2009-03-23 - 2009-03-27, Graz, Austria. ISBN 978-3-85125-036-7. Volltext nicht online. |
| Strehlau, Tobias and Doll, Ullrich and Stockhausen, Guido (2010) Entwicklung eines kombinativen Messverfahrens auf Basis spektraler Filterung von Laserstreulicht zur simultanen Bestimmung von Geschwindigkeit und Temperaturen. DLR-Interner Bericht. DLR-IB-325-01-10. Institut für Antriebstechnik. 97 S. |
| Strömer, J. and Schodl, R. (1991) Bestimmung des Folgeverhaltens von Partikeln in Überschalldüsen. DLR-Interner Bericht. 325-15-91. Volltext nicht online. |
| Stursberg, K. (1998) Technologiestudie. DLR-Interner Bericht. 325-02-98. Volltext nicht online. |
| Stursberg, K. (1991) Thrust Nozzle Test Facility at DLR Cologne. Third International Aerospace Planes Conference, 03.12.- 05.12.91, Orlando, Florida, USA. Volltext nicht online. |
| Stursberg, K. (1993) Analyse des Standes der SCRAMJET-Technologie u. Entwurfsstudie zu einem SCRAMJET-Antrieb fuer einen flugzeugaehnlichen Raumtransporter (GUS-Kooperation). DLR-Interner Bericht. 325-06-93. DLR, SM-AT. 39 S. Volltext nicht online. |
| Stursberg, K. (1993) Duesen- und Brennkammeruntersuchungen im Rahmen der MTU/DLR-Kooperation "Basistechnologieentwicklung fuer Hyperschallantriebe". DLR-Interner Bericht. 325-07-93. DLR, SM-AT. 37 S. Volltext nicht online. |
| Stursberg, K. (1997) Technologiestudie "Zerstaeubung, Mischung und Flammen-Stabilitaet in hochbelasteten, schadstoffreduzierten Brennkammern fuer militaerische Triebwerke". DLR-Interner Bericht. 325-05-97. 35 S. Volltext nicht online. |
| Stursberg, K. and Graben, M. and Heinze, J. and Hassa, C. (2000) Instabilities in Forced Lean Premixed Systems with Liquid Fuels and High Pressure. DLR-Interner Bericht. 325-05-00. 48 S. Volltext nicht online. |
| Stursberg, K. and Hungenberg, H. G. (1991) Errichtung eines Düsenprüfstandes für Hochtemperaturuntersuchungen an Schubdüsen von Hyperschallantrieben. DLR-Interner Bericht. 325-02-91. 30 S. Volltext nicht online. |
| Stursberg, K. and Hungenberg, H.G. (1993) Errichtung eines Duesenpruefstandes fuer Hochtemperaturuntersuchungen an Schubduesen von Hyperschallantrieben. DLR-Interner Bericht. 325-02-93. DLR, SM-AT. 105 S. Volltext nicht online. |
| Stursberg, K. and Meislitzer, B. and Hungenberg, H. (1995) Düsen- und Brennkammeruntersuchungen im Rahmen der MTU/DLR-Kooperation "Basistechnologieentwicklung für Hyperschallantriebe". DLR-Interner Bericht. 325-07-95. 87 S. Volltext nicht online. |
| Stursberg, K. (1992) Versuchsanlage fuer die Untersuchung von RAM/SCRAM-Schubduesen bei der DLR. DLR-Interner Bericht. 325-09-92. SM-AT. Volltext nicht online. |
| Störmer, J. and Schodl, R. (1991) Bestimmung des Folgeverhaltens von Partikeln in Überschalldüsen mit chemischer Reaktion. DLR-Interner Bericht. 325-16-91. 43 S. Volltext nicht online. |
| Störmer, J., Förster, W., (1991) Erweiterung des Simulationsprogramms für das Laser-2-Fokus -Verfahren. DLR-Interner Bericht. 325-17-91. 75 S. Volltext nicht online. |
| Sun, X. and Neise, W. (1995) On the Relation between Higher-order Acoustic Modes and In-duct Sound Power Measurement. In: Proc. First CEAS/AIAA Aeroacoustics Conference, pp. 1075-1084. First CEAS/AIAA Aeroacoustics Conference (16th AIAA Aeroacoust. Conference), Munich, 12-15 June 1995. Volltext nicht online. |
| Süß, Fabia and Schöffler, Robin and Friedrich, Lion and Petersen, Anna and Vogel, Felix and Friess, Martin and Ebach-Stahl, Andrea (2024) Design and Manufacture of liquid silicon infiltration based SiC/SiC nozzle guide vanes for high-pressure turbines. 14th International Conference on Ceramic Materials and Components for Energy and Environmental Systems, 2024-08-18 - 2024-08-22, Budapest, Ungarn. Volltext nicht online. |
| Süß, Fabia and Schöffler, Robin and Friedrich, Lion and Petersen, Anna and Vogel, Felix and Friess, Martin and Ebach-Stahl, Andrea (2024) Design and Manufacture of EBC Coated SiC/SiC Nozzle Guide Vanes for High-Pressure Turbines. In: 69th ASME Turbo Expo 2024: Turbomachinery Technical Conference and Exposition, GT 2024. ASME Turbo Expo 2024: Turbomachinery Technical Conference and Exposition, 2024-06-24 - 2024-06-28, London, Vereinigtes Königreich. doi: 10.1115/GT2024-126286. ISBN 978-079188807-0. Volltext nicht online. |
| Süß, Fabia and Schöffler, Robin and Friedrich, Lion and Petersen, Anna and Vogel, Felix and Friess, Martin and Ebach-Stahl, Andrea (2024) Design and Manufacture of SiC/SiC Nozzle Guide Vanes With Environmental Barrier Coatings for High-Pressure Turbines. Journal of Engineering for Gas Turbines and Power (147(2)), 021021-1. American Society of Mechanical Engineers (ASME). doi: 10.1115/1.4066436. ISSN 0742-4795. Volltext nicht online. |
| Tapken, Ulf and Lengyel-Kampmann, Timea and Belz, Joachim and Stürmer, Arne and Otten, Tom (2022) Auswirkung von Grenzschichteinsaugung auf Triebwerkfans: Aerodynamik, Aeroelastik, Strukturmechanik und Akustik - Übersicht über das Projekt AGATA3S. In: DGLR-Publikationsdatenbank. Deutsche Gesellschaft für Luft- und Raumfahrt - Lilienthal-Oberth e.V., Bonn. Deutscher Luft- und Raumfahrtkongress 2022, 2022-09-27 - 2022-09-29, Dresden. doi: 10.25967/570299. |
| Theisen, P. (1995) Erweiterung der Diskreten-Transfer-Methode zur Strahlungsberechnung auf unstrukturierten Netzen und Anwendung in einem H2-betriebenen Ramjet-Antrieb. Diploma, Universität Stuttgart?. Volltext nicht online. |
| Tiedemann, M. (2000) High frequency blade surface temperature determination using surface mounted hotfilm gauges. XVth Bi-Annual Symposium on Measuring Techniques in Transonic and Supersonic Flows in Cascades and Turbomachines, Florence, 21.-22. September 2000, Florenz. Volltext nicht online. |
| Tiedemann, M. and Rehder, H.-J. (2002) Überprüfung der Kalibration der neuen Keilsonde KWU3. DLR-Interner Bericht, Project Report. 225-2002 C 05. 66 S. Volltext nicht online. |
| Tolgos, S. and Weber, A. (1996) Optimierte Tandemgitterkonfigurationen. 5. Statusseminar Arbeitsgemeinschaft Hochtemperatur-Gasturbine, 5.-6.12.96, DLR Koeln-Porz. Volltext nicht online. |
| Tosun, Adem (2022) Implicit Large Eddy Simulation of a Low-Pressure Turbine Cascade with resolved Endwall Boundary Layers. Master's, TU Darmstadt. Volltext nicht online. |
| Towfighi, K. (1994) Navier Stokes Berechnungen mit dem Code "Birdy" - Stroemungen mit Rotation -. Vortrag in Besprechung bei der MTU Muenchen am 13.09.94. Volltext nicht online. |
| Trost, Marco and Spinner, Sebastian (2020) Design Optimization of a rear Fuselage Fan for different Boundary Layer Profiles. 20. Onera-DLR Aerospace Symposium (ODAS), 2020-11-17 - 2020-11-19, Braunschweig, Germany. Volltext nicht frei. |
| Tröltzsch, Anke and Becker, Richard-Gregor and Siggel, Martin (2017) The SQP Trust-Region Algorithm ECDFO Applied to the Optimization of an Aero Engine Performance Model. In: 4th International Conference on Optimization Methods and Software 2017, p. 73. Taylor & Francis Group. 4th International Conference on Optimization Methods and Software 2017, 2017-12-16 - 2017-12-20, Havanna, Kuba. Volltext nicht online. |
| Unger, W. (1995) Entwicklung eines Lichtwellenleiterübertragungssystems für die Erzeugung von Lichtschnitten zur Strömungssichtbarmachung. DLR-Interner Bericht. 325-01-95. 92 S. Volltext nicht online. |
| Villena Munoz, Cristina and Lawson, Craig and Riaz, Atif and Jaron, Robert (2024) Conceptual Design of Supersonic Aircraft to Investigate Environmental Impact. In: AIAA SciTech 2024 Forum. AIAA SCITECH 2024 Forum, 2024-01-08 - 2024-01-12, Orlando, FL. doi: 10.2514/6.2024-2115. ISBN 978-162410711-5. Volltext nicht online. |
| Vogel, D. T. (1994) Numerische Simulation der Filmkuehlung. Seminarvortrag SM-AT, 07.09.93, Köln-Porz. Volltext nicht online. |
| Vogel, D. T. (1994) Filmkuehlung an Turbinen. FVV Filmkuehlung am 10.12.93 in München, Uni der Bundeswehr. Volltext nicht online. |
| Vogel, D. T. (1993) Navier-Stokes Calculation of Turbine Flows with Heat Transfer and Film Cooling. In: Proc. Int. Symp. GT and Gas Cycle Plants (1993). Int. Symposium GT and Gas Cycl Plants Bled Slowenien. Volltext nicht online. |
| Vogel, D.T. (1998) Numerical Investigation of the Influence of Specific Vortex Generation on the mixing process of Film Cooling Jets. ASME-Tagung, 1998. Volltext nicht online. |
| Vogel, D.T. (1994) Navier-Stokes Berechnung filmgekuehlter Turbinen. Vortrag bei der MTU-Muenchen, 01.02.1994. Volltext nicht online. |
| Vogel, D.T. (1994) Numerische Berechnungen mit dem Code "Birdy" -Stroemung mit Ausblasung und Waermeuebertragung-. Vortrag in Besprechung bei der MTU-Muenchen, 13.09.1994. Volltext nicht online. |
| Vogel, D.T. (1995) Berechnungsmethoden bei der Turbomaschinenauslegung, Zusammenarbeit DLR-MTU. In: DGLR-J 795-030. Vortrag auf der DGLR-Jahresveranstaltung in Bonn, Bad Godesberg, 28.09.1995. Volltext nicht online. |
| Vogel, D.T. (1994) Navier-Stokes Calculation of Turbine Flows with Film-Cooling. 19th Congress ICAS / AIAA, Anaheim, USA, 18-23 Sept., 1994. Volltext nicht online. |
| Vogel, D.T. (1994) Recent Progress of Numerical Turbine Flow Simulation at the DLR. ERCOFTAC Meeting, 25-26 April 1994, Ecole Centrale Lyon. Volltext nicht online. |
| Vogel, D.T. (1994) Numerische Simulation der Kuehlluftausblasung an Turbinen. Vortrag bei der MTU Muenchen, 13.09.94. Volltext nicht online. |
| Vogel, D.T. (1994) Simulation von Turbinenstroemungen auf einem Hochleistungsrechner. erscheint in BITmap. Volltext nicht online. |
| Vogel, D.T. (1994) Numerical Activities at the Institute of Propulsion Technology, DLR. Vortrag NTH Trondheim, Norwegen, 28.11.1994. Volltext nicht online. |
| Vogel, D.T. (1995) The Interaction between Film Cooling and Secondary Flow in a Turbine Stator Investigation of Reynolds and Turbulence Model Influence. 6th ISCFD in Lake Tahoe Nevada, USA, 4.-8.Sept. 1995. Volltext nicht online. |
| Vogel, D.T. (1995) Berechnungsmethoden bei der Turbomaschinenauslegung; Zusammenarbeit DLR-MTU, Teil A. DGLR Jahrestagung, Bonn, Bad Godesberg, 28.09.1995. Volltext nicht online. |
| Vogel, D.T. (1996) Navier-Stokes Simulation of the Flow around a Leading Edge Film-Cooled Turbine Blade Including the Interior Cooling System and Comparison with Experimental Data. ASME-Paper, presented at the Int. Gas Turbine and Aeroengine Congress & Exhibition, Birmingham, UK, June 10-13, 1996. Volltext nicht online. |
| Vogel, D.T. (1996) Numerische Untersuchung des Mischungsverhaltens von Filmkühlstrahlen in Turbinenströmungen. DLR-Forschungsbericht. 96-35. Dissertation. 116 S. Volltext nicht online. |
| Vogel, D.T. and Eulitz, F. and Carstens, C. and Fritsch, G. and Henne, J. (1998) Entwurfs- und Berechnungsverfahren für Triebwerkskomponenten aus der Kooperation MTU München und DLR. DGLR Jahrestagung, Bremen, 6.10.98. Volltext nicht online. |
| Vogel, D.T. and Wilfert, G. (ABB) and Fottner, L. (UNI-BW Muenchen) (1995) Numerical and Experimental Investigation of Film-Cooling from a Row of Hole at the Suction Side of a Highly Loaded Turbine Blade. 12th ISABE Conference, 11.-15. Sept., 1995, Melbourne, Australien. Volltext nicht online. |
| Vogel, T. (1991) Computation of 3D-Viscous Flow and Heat Transfer for the Application to Film-Cooled Gas Turbine Blades. AGARD, San Antonio, 27.-31.1991. Volltext nicht online. |
| Vogel, T. (1994) Navier-Stokes Calculation of Turbine Flows with Film Cooling. 19th Congress ICAS/AIAA, 18-23 Sept.1994, Anaheim, USA. Volltext nicht online. |
| Vogel, T. (1994) Recent Progress of Numerical Turbine Flow Simulation at the DLR. ERCOFTAC-Meeting, 25-26 April 1994, Ecole Centrale de Lyon. Volltext nicht online. |
| Vogel, T. (1994) Numerische Simulation der Kuehlluftausblasung an Turbinen. Vortrag MTU, 13.09.94, Muenchen. Volltext nicht online. |
| Vogel, T. (1994) Simulation von Turbinenstroemung auf einem Hochleistungsrechner. In: BITmap, Mitteilung der Zentralen Datenverarbeitung der DLR, 3/94. Vortrag, NEC/DLR-Symposium, DLR Goettingen. Volltext nicht online. |
| Vogel, T. (1994) Numerical Activities at the Institute of Propulsion Technology, DLR. CFD Norway/NTH Trondheim, 28. Nov. 1994, Trondheim Norwegen. Volltext nicht online. |
| Vogel, T. (1994) Nachrechnung einer filmgekuehlten, hochbelasteten Turbinenschaufel. Vortrag, Bundeswehrhochschule Muenchen, Institut fuer Strahlantriebe, 24.Juni 1994, Muenchen. Volltext nicht online. |
| Vogel, T. and Kügeler, E. (1999) The Generation of Artificial Counter Rotating Vortices and the Application for Fan-Shaped Film-Cooling Holes. In: Abstracts from the 14th International Symposium on Air Breathing Engines, 73-. XIV ISABE, Florenz, Italien, 8.9.1999. ISBN 1-56347-357-7. Volltext nicht online. |
| Voges, Melanie and Beversdorff, Manfred and Willert, Chris and Krain, Hartmut (2007) Application of Particle Image Velocimetry to a Transonic Centrifugal Compressor. Experiments in Fluids. Springer Verlag. doi: 10.1007/s00348-007-0279-1. Volltext nicht online. |
| Voges, Melanie and Klinner, Joachim and Willert, Chris and Beversdorff, Manfred and Schodl, Richard (2007) Assessment of Powder-based Seeding Materials for PIV Applications in Transonic, Supersonic and Reacting Flows. In: PIV'07. 7th International Symposium on Particle Image Velocimetry, 2007-09-11 - 2007-09-14, Rome, Italy. Volltext nicht online. |
| Voges, Melanie and Klinner, Joachim and Willert, Chris and Blümcke, Erich (2007) PIV MESSUNGEN IN INTERAGIERENDEN ÜBERSCHALL-FREISTRAHLEN IN DRUCKBELASTETER UMGEBUNG. In: GALA 2007. 15. Fachtagung Lasermethoden in der Strömungsmesstechnik, 2007-09-04 - 2007-09-06, Rostock. Volltext nicht online. |
| Voges, Melanie and Willert, Christian (2007) PIV Applied to a Transonic Centrifugal Compressor. In: Particle Image Velocimetry, a practical guide (second edition) Experimental Fluid Mechanics. Springer Verlag, Berlin, Heidelberg, New York. pp. 332-339. ISBN 978-3-540-72307-3. Volltext nicht online. |
| Voges, Melanie and Willert, Christian and Mönig, Reinhard and Schiffer, H.-P. (2013) The Effect of a Bend-Slot Casing Treatment on the Blade Tip Flow Field of a Transonic Compressor Rotor. In: ASME-Paper, GT2013-94006. ASME Turbo Expo: Power for Land, Sea and Air, 2013-06-03 - 2013-06-07, San Antonio, Texas, USA. doi: 10.1115/GT2013-94006. Volltext nicht online. |
| Voges, Melanie and Beversdorff, Manfred and Willert, Chris and Krain, Hartmut (2006) Application of Particle Image Velocimetry to a Transonic Centrifugal Compressor. 13th International Symposium on "Applications of Laser Techniques to Fluid Mechanics", 2006-06-26 - 2006-06-29, Lisbon, Portugal. Volltext nicht frei. |
| Voges, Melanie and Klinner, Joachim and Willert, Christian (2008) Stereo PIV Messungen in einer atmosphärischen Gasturbinenbrennkammer. In: DIV4 - Diagnostik in Verbrennungen. DIV4, 2008, 2008-10-16 - 2008-10-17, Köln. (Unpublished) Volltext nicht frei. |
| Voges, Melanie and Schnell, Rainer and Willert, Christian and Mönig, Reinhard and Müller, Martin W. and Zscherp, Carsten (2008) Investigation of Blade Tip Interaction with Casing Treatment in a Transonic Compressor - Part 1: Particle Image Velocimetry. In: ASME-Paper, GT2008-50210. ASME Turbo Expo 2008, 2008-06-09 - 2008-06-13, Berlin, Germany. Volltext nicht frei. |
| Voges, Melanie and Willert, Christian and Müller, Martin W. (2008) PIV Application to Transonic Axial and Radial Compressors. XIX Biannual Symposium on Measuring Techniques in Turbomachinery - Transonic and Supersonic Flow in Cascades and Turbomachines, 2008-04-07 - 2008-04-08, Rhodes-St-Genèse, Belgien. Volltext nicht frei. |
| Voges, Melanie and Willert, Christian and Schnell, Rainer and Müller, Martin W. and Zscherp, Carsten (2008) PIV Application for Investigation of the Rotor Blade Tip Interaction with a Casing Treatment in a Transonic Compressor Stage. 14th International Symposium on Applications of Laser Techniques to Fluid Mechanics, 2008-07-07 - 2008-07-10, Lisbon, Portugal. |
| Voigt, P. (1999) Entwicklung und Einsatz eines Laserlichtschnittverfahrens zur quantitativen Konzentrationsmessung bei Mischungsprozessen. DLR-Forschungsbericht. 1999-41. Dissertation. 104 S. Volltext nicht online. |
| Voigt, P. and Schodl, R. and Griebel, P. (1997) Using the Laser Light Sheet Technique in Combustion Research. In: Proc. 90th Symp. of AGARD-PEP on "Advanced Non-intrusive Instrumentation for Propulsion Engines"" 1997. 90th Symp. of AGARD-PEP on "Advanced Non-intrusive Instrumentation for Propulsion Engines", Oct. 20-24, Bruessel, 1997. Volltext nicht online. |
| Voigt, P. and Theisen, P. (1999) Experimental Analysis of Unsteady Mixing in an RQL Combustor Segment aimed for Validation of PDF Models in the Thrust Code. In: Notes on Numerical Fluid Mechanics. Vieweg Verlag. 11. AG STAB/DGLR Symposium 98, Berlin, 10.-12.11.98. Volltext nicht online. |
| Voigt, Christiane and Schumann, Ulrich and Jurkat, Tina and Schäuble, Dominik and Schlager, Hans and Petzold, Andreas and Gayet, J.-F. and Krämer, M. and Schneider, J. and Borrmann, S. and Schmale, J. and Jessberger, Philipp and Hamburger, T. and Lichtenstern, Michael and Scheibe, Monika and Gourbeyre, C. and Meyer, J. and Kübbeler, M. and Frey, W. and Kalesse, H. and Butler, T. and Lawrence, M.G. and Holzäpfel, Frank and Arnold, E. and Wendisch, Manfred and Döpelheuer, A. and Gottschaldt, Klaus-Dirk and Baumann, Robert and Zöger, Martin and Sölch, Ingo and Rautenhaus, Marc and Dörnbrack, Andreas (2010) In-situ observations of young contrails – overview and selectedresults from the CONCERT campaign. Atmospheric Chemistry and Physics, 10, pp. 9039-9056. Copernicus Publications. doi: 10.5194/acp-10-9039-2010. ISSN 1680-7316. |
| Walek, M. (1999) Optimierung des Stators der 2. Stufe des Niederdruckverdichters hohen Druckverhältnisses in Leichtbauweise. DLR-Interner Bericht. 325-03-99. Diploma. 79 S. Volltext nicht online. |
| Wallscheid, L. (1998) On the steady and unsteady effects of blade row spacing in a counterrotating ducted propfan. ICAS-Paper, Sept. 15, 1998, Melbourne, Australia. Volltext nicht online. |
| Wallscheid, L. (1999) Phänomenologische Untersuchung der zeitabhängigen Strömung in einem gegenläufigen Propfan. DLR-Forschungsbericht. 1999-24. Dissertation. Volltext nicht online. |
| Wallscheid, L. (2001) Entwicklungstendenzen bei luftatmenden Triebwerken aus Sicht der Forschung. Aktuelle Triebwerkstechnologien, Mannheim, 8.11.2001. Volltext nicht online. |
| Wallscheid, L. (1993) Geometriegenerierung fuer transsonische Radialverdichter. Other. Dipl.-Arbeit, Universität Bochum (RUB), Oktober 1993. 109 S. Volltext nicht online. |
| Wallscheid, L. (1997) Investigation of Rotor/Rotor-Interaction. In: Proc. XIII ISABE 1997. XIII ISABE, Sept. 7-12, 1997. Volltext nicht online. |
| Wallscheid, L. and Eulitz, F. and Heinecke, R. (1998) Investigation of Unsteady Flow Phenomena in a Counterrotating Ducted Propfan. ASME Tagung 1998. Volltext nicht online. |
| Weber, A. (2004) G3DMESH - New of Improved Application Subroutines. DLR-Interner Bericht. 325-03-04. 103 S. Volltext nicht online. |
| Weber, A. (1995) Entwicklung eines hochumlenkenden transsonischen Leitradgitters. Project Report, DLR-Interner Bericht. 4 S. Volltext nicht online. |
| Weber, A. (1995) Entwicklung eines hochumlenkenden transsonischen Leitradgitters. Project Report, DLR-Interner Bericht. 8 S. Volltext nicht online. |
| Weber, A. (1995) Entwicklung eines hochumlenkenden transsonischen Leitradgitters. In: Arbeitskreissitzung AG Turbo Turbotech, Okt. 1995. Volltext nicht online. |
| Weber, A. (1996) Validierung von drei Navier-Stokes-Codes an einem transsonischen Verdichtergitter unter rein 2-dimensionalen Bedingungen. DLR-Interner Bericht. 325-09-96. 44 S. Volltext nicht online. |
| Weber, A. and Fuchs, R. and Schreiber, H.A. (1999) Räumliche Strömung im transsonischen Verdichtergitter sehr hoher Belastung - Studien zur Randzonenbeeinflussung. AG-TURBO TURBOTECH, Arbeitskreissitzung, Köln, 14.-15.Okt. 1999. Volltext nicht online. |
| Weber, A. and Fuchs, R. and Schreiber, H.A. and Steinert, W. (2000) Räumliche Strömungen in transsonischen Verdichtergittern sehr hoher Belastung. Abschlussbericht HTGT-TURBOTECH II, Teilvorhaben 1.132, AG-TURBO. Volltext nicht online. |
| Weber, A. and Nicke, E. (1997) A Study of Blade Sweep on the Performance of a Transonic Compressor Cascade with and without Endwall Influence. In: Proc. 13th Int. Symposium on Air Breathing Engines (ISABE) 1997. 13th Int. Symposium on Air Breathing Engines (ISABE), 8.-12.9.97. Volltext nicht online. |
| Weber, A. and Schreiber, H. A. and Fuchs, R. and Steinert, W. (2002) 3-D Transonic Flow in a Compressor Cascade With Shock-Induced Corner Stall. ASME Journal of Turbomachinery, Vo. 124, July 2002, pp. 358-366. Volltext nicht online. |
| Weber, A. and Schreiber, H.A. and Fuchs, R. and Steinert, W. (2001) 3D Transonic Flow in a Compressor Cascade with Shock-Induced Corner Stall. The 46th ASME International Gas Turbine and Aeroengine Technical Congress, New Orleans, USA, June 4-7, 2001. Volltext nicht online. |
| Weber, A. and Schreiber, H.A. and Fuchs. R., and Steinert, W. (2001) 3D Transonic Flow in a Compressor Cascade with Shock-Induced Corner Stall. In: ASME Turbo Expo 2001, pp. 1-12. ASME Turbo Expo 2001, New Orleans, USA, June 4-7, 2001. Volltext nicht online. |
| Weber, A. and Steinert, W. (1997) Design, Optimization and Analysis of a High-Turning Transonic Tandem Compressor Cascade. In: ASME-Paper. Volltext nicht online. |
| Weber, A. and Steinert, W. and Fuchs, R. and Schreiber, H.A. (1999) Testcase: 3D Flow in a Transonic Compressor Cascade (DLR TSG-97). DLR-Interner Bericht. 325-6-99. 33 S. Volltext nicht online. |
| Weber, A. and Steinert, W. and Starken, H. (1991) Design and analysis of a high pitch to chord ratio cascade representative of ducted propfans. The 36th ASME International Gas Turbine and Aeroengine Congress and Exposition, Orlando (USA), 03.-06.06.91. Volltext nicht online. |
| Weber, A. and Tolgos, S. (1996) Optimierte Tandemgitterkonfigurationen. 5. Statusseminar, Arbeitsgemeinschaft Hochtemperatur-Gasturbine, Sekretariat AG-Turbo, DLR, Koeln-Porz. Volltext nicht online. |
| Weber, Anton (2004) 3D Structured Grids for Multistage Turbomachinery Applications based on G3DMESH (1st. Revision). DLR-Interner Bericht. 325-05-04. 77 S. Volltext nicht online. |
| Weber, Anton (2004) G3DMESH - New or Improved Application Subroutines. DLR-Interner Bericht. 325-03-04. 103 S. Volltext nicht online. |
| Wegener, D. (1990) Eine Methode zur Bestimmung der Lage und Intensitaet von Sekundaerwirbeln in Turbinen. DLR-Interner Bericht. 325-07-90. 100 S. Volltext nicht online. |
| Wegener, D. (1991) Analyse der Strömungsverluste in einem Turbinenstator. DLR-Interner Bericht. 325-04-91. 34 S. Volltext nicht online. |
| Wegener, D. (1991) Sekundärströmanalyse in Turbinenstatoren. Kolloquium Energietechnik an der RUB, 29.10.1991. Volltext nicht online. |
| Wegener, D. (1991) The Secondary Vortex Theory as a Result from Advanced Measurements and Calculations. In: Third European Propulsion Forum 1991, Paris, November 1991. Volltext nicht online. |
| Wegener, D. (1991) Turbine Stator Flow Analysis: Measurements, Calculations and Cooperation with ONERA. Köln, 05.12.1991. Volltext nicht online. |
| Wegener, D. (1991) Rechenprogramm WIRBEL zur Analyse der Sekundärwirbel in einem Turbinenstator. DLR-Interner Bericht. 325-10-91. 69 S. Volltext nicht online. |
| Wegener, D. (1991) Analyse der Strömungsverluste in einem Turbinenstator. DLR-Interner Bericht. 325-04-91. 34 S. Volltext nicht online. |
| Wegener, D. (1991) Analyse der Sekundärströmungen in einem Turbinenstator. Besuch Walter Kröll im Institut AT. Volltext nicht online. |
| Wegener, D. (1995) Analyse der Sekundärströmungswirbel in Turbinenstatoren unter besonderer Berücksichtigung der Eintrittsgrenzschichten. DLR-Forschungsbericht. 95-17. Dissertation. 112 S. Volltext nicht online. |
| Wegener, D. and Le Meur, A. and Billonnet, B. and Escande, B. and Joudren, C. (1992) Comparison between two 3D-NS-Codes and Experiment on a turbine stator. In: 28th Joint Propulsion Conference Nashville, Tennessee, 6-8 July 1992. Volltext nicht online. |
| Wehr, Lorin and Kutne, Peter and Meier, Wolfgang and Becker, Julian (2005) 1 D Single-Pulse Raman Measurements of Temperature and Mixture Fraction in a Gas Turbine Model Combustor at Elevated Pressure. In: Konferenz CD. 2. European Combustion Meeting, 2005-04-03 - 2005-04-06, Louvain-la-Neuve, Belgien. Volltext nicht online. |
| Weiand, Peter and Schwinn, Dominik and Becker, Richard-Gregor and Weber, Thomas and Atci, Kagan and Moerland-Masic, Ivana and Reimer, Fabian (2022) Sizing of a New SAR Helicopter for a Future HEMS Environment. Deutscher Luft- und Raumfahrtkongress 2022, 2022-09-27 - 2022-09-29, Dresden. Volltext nicht online. |
| Weimann, C. (1996) Numerische Untersuchung zum Rotating-Stall-effekt in einer Verdichterstufe. Other. 92 S. Volltext nicht online. |
| Weisgerber, H. (2002) Experimentelle Untersuchungen zur Nichtgleichgewichtsexpansionsströmung nach Wasserstoff/Luft-Verbrennung in Hyperschall Staustrahltriebwerken. DLR-Forschungsbericht. 2002-03. Dissertation. Volltext nicht online. |
| Weisgerber, H. and Fischer, M. and Magens, E. and Beversdorff, M. and Link, T. and Koschel, W. (1999) Experimental and Numerical Analysis of an Expansion Flow in Chemical and Thermal Nonequilibrium. In: Fourteenth International Symposium on Air Breathing Engines. AIAA. XIV ISABE, Florence, Italy; 5-10 September, 1999. ISBN 1-56347-357-7. Volltext nicht online. |
| Weisgerber, H. and Fischer, M. and Magens, E. and Winandy, A. and Beversdorff, M. Foerster, W., and Cordes, S. and Meislitzer, B. (1997) Experimentelle Untersuchungen zur Expansionsstroemung nach Wasserstoff/Luft-Verbrennung in luftatmenden Hyperschallantrieben. DLR-Interner Bericht. 325-04-97. 23 S. Volltext nicht online. |
| Weisgerber, H. and Fischer, M. and Magens, E. and Winandy, A. and Förster, W. and Beversdorff, M. (1998) Experimental Analysis of Exhaust Gas in a Hypersonic Nozzle. AIAA 8th International Space Planes and Hypersonic Systems and Technologies Conference, Norfolk, VA, 27-30 April, 1999. Volltext nicht online. |
| Weiskat, D. (1998) Idealisierung und Integration einer manuellen Steuerung in ein FE-Modell eines Segelflugzeuges. DLR-Interner Bericht. 232 - 98 J 01. Volltext nicht online. |
| Weyer, H. B. (1990) Analyse der grundlegenden Stroemungsphaenomene in Propfans. Kolloquiumsvortrag an der Universitaet Stuttgart am 18. Oktober 1990. Volltext nicht online. |
| Weyer, H. B. (1990) Moeglichkeiten der Forschung an gegenlaeufigen Propfan-Triebwerken in der DLR. Seminarvortrag an der Technischen Universitaet Muenchen, 11. Januar 1 990. Volltext nicht online. |
| Weyer, H. B. (1990) Technologiearbeiten und Testaktivitaeten der DLR. Planung des Demonstratorprogramms, BMFT, Bonn, 15. Februar 1990.. Volltext nicht online. |
| Weyer, H. B. (1991) Aerodynamische Grundlagen der Propfans. Kolloquiumsvortrag an der Universität GH Essen, Mechanik und Strömungsmechanik, Prof. Merzkirchen, am 27.06.91. Volltext nicht online. |
| Weyer, H. B. (1995) Recent Results of DLR-Aeroengine Research. NAL, Tokyo, 11.07.1995. Volltext nicht online. |
| Weyer, H. B. and Neise, W. and Möser, M.. (2003) Schallentstehung bei Radialverdichtern. Abschluss-und Zwischenberichter der Foschungstellen, R520, pp. 129-141. Volltext nicht online. |
| Weyer, H.B. (1991) Weniger Umweltbelastung durch neue Luftfahrtantriebe. Other. 1991. AGF. 3 S. Volltext nicht online. |
| Weyer, H.B. (1991) Schadstoffe in der Luftfahrt, Wirkung und Prävention, Vorschlag eines Verbundforschungs- und Technologieprogramms. Vortrag anläßl. der DGLR-Jahrestagung am 12.09.91. Volltext nicht online. |
| Weyer, H.B. (1991) Schadstoffe in der Luftfahrt - Ein Verbundprogramm von Forschung und Industrie. Parlamentarischer Abend in Bonn am 19.03.1991 und Parlamentarischer Abend in München am 11.07.1991. Volltext nicht online. |
| Weyer, H.B. (1991) Grundlagen der Propfanströmung. Seminarvortrag an der TU Berlin, Inst. f. Luft- und Raumfahrt, Prof. Haberland , am 28.06.1991. Volltext nicht online. |
| Weyer, H.B. (1991) Emissionen des Luftverkehrs und Luftfahrttechnologie der Zukunft. Vortrag bei Deutsche Physikalische Gesellschaft, Arbeitskreis Energie am 24.10.91. Volltext nicht online. |
| Weyer, H.B. (1991) Technologie künftiger schadstoffarmer Triebwerke. Seminarvortrag an der TU München am 07.11.91. Volltext nicht online. |
| Weyer, H.B. (1994) Luftverkehr und Umwelt - eine technologische Herausforderung. Vortrag an der Uni Koeln, Geowissenschaftl. Sonderkolloquium, 27.1.94. Volltext nicht online. |
| Weyer, H.B. (1994) Kraftwerke der Zukunft - Fossile und solare Entwicklungstrends. Zentrumskolloquium am 18.05.94 in Stuttgart. Volltext nicht online. |
| Weyer, H.B. (1993) Moeglichkeiten zur Verringerung der Schadstoffe in der Luftfahrt. Seminarvortrag TH Darmstadt, 26.01.1993, Darmstadt. Volltext nicht online. |
| Weyer, H.B. (1994) Technologiemotor Luft- und Raumfahrt. Vortrag auf BDLR-Veranstaltung in Bonn, 23.Juni 1994. Volltext nicht online. |
| Weyer, H.B. (1994) Probleme der Luftfahrt - Umwelt und Ressourcen. JHV der DLR - 25 Jahre DLR - im Forum d. Kunst- u. Ausstellungshalle d. Bundesrepublik Deutschland, 30.11.1994, Bonn. Volltext nicht online. |
| Weyer, H.B. (1993) Forschung zur Hochtemperaturgasturbine. Praesentation der GFE-Forschungsvorhaben in der Kraftwerkstechnik mit fossilen Brennstoffen, Beitraege der DLR zur AG TURBO, 26.6.93,DLR-KP. Volltext nicht online. |
| Weyer, H.B. (1995) Das Flugzeug von morgen - Neue Triebwerkskonzepte -. Zentrumskolloquium DLR-Koeln, 05.09.1995. Volltext nicht online. |
| Weyer, H.B. (1995) Luftfahrtantriebe - aktuelle Forschung in der DLR. Professorenexkursion, DLR Koeln-Porz, 18.05.1995. Volltext nicht online. |
| Weyer, H.B. (1995) Das Flugzeug von morgen -Neue Triebwerkskonzepte-. Zentrumskolloquium DLR Koeln-Porz, 05.09.1995. Volltext nicht online. |
| Weyer, H.B. (1995) Schadstoffemissionen des Luftverkehrs -Stand und Erfordernisse-. Vortrag CDU-Fraktionsvorstand NRW, Hotel Holiday-Inn Flughafen 04.12.1995. Volltext nicht online. |
| Weyer, H.B. (1995) Triebwerkstechnologien. Überprüfung des SP-Luftfahrt, DLR Köln-Porz, 04.12.1995. Volltext nicht online. |
| Weyer, H.B. (1995) Schadstoffaspekte des Luftverkehrs. Vortrag Verwaltungsrat des RW TUEV, Essen, 11.12.1995. Volltext nicht online. |
| Weyer, H.B. (1995) Verbrennungszentrum der DLR. Vortrag ABB, Baden, 24.03.1995. Volltext nicht online. |
| Weyer, H.B. (1995) Verbrennungszentrum der DLR. BMW Rolls-Royce, Dahlewitz bei Berlin, 29.05.1995. Volltext nicht online. |
| Weyer, H.B. (1995) Triebwerksforschung in der DLR. Seminar aus Anlass der Exkursion der Maschinenbauprozessoren der TH Darmstadt, Koeln-Porz, 21.06.1995. Volltext nicht online. |
| Weyer, H.B. (1995) Recent results of DLR-research on aircraft engines. Seminar NAL - Tokyo, 11.07.1995. Volltext nicht online. |
| Weyer, H.B. (1996) Kooperation bei zukuenftigen Antrieben - Neue Wege der Zusammenarbeit-. Senatsvortrag, 60. Sitzung des Senats, DLR Köln-Porz, 30. Mai 1996. Volltext nicht online. |
| Weyer, H.B. (1996) Cooperation in Aircraft Propulsion - Propfan Technology - Low NOx Combustion. NAL-DLR Workshop, 12/13. März 1996, DLR Köln-Porz. Volltext nicht online. |
| Weyer, H.B. (1996) Schadstoffaspekte der Fluggasturbine - Abgasemission und ihre Reduktion -. ILA 96 - Aktionsfeld Luftfahrt-Forum, Berlin, 18.5.96. Volltext nicht online. |
| Weyer, H.B. and Isermann, U. and Samel, A. and Griefahn, B. and Marohn, H.D. (2003) Verkehrslärmwirkungen - Verkehrslärmminderung. 5. Kongress "Medicine and Mobility", 41. Jahrestagung der DGLRM, Berlin, 18.-20.09.03, -. Volltext nicht online. |
| Weyer, Heinrich B. (1993) Luftverunreinigung durch Luftfahrzeuge. Seminar zum Thema: Luftverunreinigung durch Luftfahrzeuge, Frankfurt Flughafen, 10.03.93. Volltext nicht online. |
| Wiegand, H. (1995) Diffusor-Modelluntersuchungen zur Optimierung der Diffusorgeometrie eines Hyperschalldiffusors. DLR-Interner Bericht. 325-06-95. 20 S. Volltext nicht online. |
| Wiegand, H. and Stursberg, K. (1990) Entwicklung eines Brennkammer-Duesen-Pruefstandes fuer die Erprobung von Schubduesen fuer den Hyperschallflug. DLR-Seniorentreffen am 29. November 1990 im FZ Koeln-Porz. Volltext nicht online. |
| Wiegand, H. and Pilz, E. and Rath, K. (1992) Untersuchungen an Modellen von Ueberschall-Unterschall-Diffuso- ren fuer die HYTEX-Duese. DLR-Interner Bericht. 325-07-92. SM-AT. 85 S. Volltext nicht online. |
| Willert, C. (2001) PIV in Flames. Vortrag am PIV NET workshop 3.3, June 7/8, Cologne, 2001. Volltext nicht online. |
| Willert, C. (2002) Planar Doppler Velocimetry - Activities at DLR Cologne. Seminar des "Association Francophone de Vélocimetrie Laser" (AFVL), Meudon, France, 16. Sep. 2002.. Volltext nicht online. |
| Willert, C. (2004) Proposal for NetCDF (re)implementation for use with Planar Velocimetry Data. In: Particle Image Velocimetry: Recent Improvements, pp. 251-260. Springer-Verlag Berlin Heidelberg. EUROPIV 2 Workshop, Zaragoza, Spain, 31.03.- 01.04.2003. ISBN 3-540-21423-2. Volltext nicht online. |
| Willert, C. (2004) Application potential of advanced PIV algoritms for industrial applications. 7th Workshop on PIV, Lisbon (Pt), 9-10 July 2004. Volltext nicht online. |
| Willert, C. and Blümcke, E. and Beversdorff, M. and Unger, W. (2000) Application of Phase-Averaging Doppler-Global Velocimetry to Engine Exhaust Flows. 10th International Symposium on Applications of Laser Techniques to Fluid Mechanics, Lisboa, Portugal, July 10-13, 2000. Volltext nicht online. |
| Willert, C. and Jarius, M. (2001) Planar Flow Filed Measurements in Atmospheric and Pressure Combustion. In: International Symposium on Particle Image Velocimetry. 4th Int. Symposium on Particle Image Velocimetry (PIV), DLR-Göttingen, Germany, September 17-19, 2001. Volltext nicht online. |
| Willert, C. and Jarius, M. (2002) Planar flow field measurements in atmospheric and pressurized combustion chambers. Experiments in Fluids, 33 (6), pp. 931-939. Volltext nicht online. |
| Willert, C. and Roehle, I. (2000) Mesure des frois composantes de la vitesse par DGV: moyenne tempore 16 on moyenne de phase. Marseille, 12.-22. Sept. 2000. Volltext nicht online. |
| Willert, C. and Roehle, I. and Schodl, R. and Dingel, O. and Seidel, T. (2002) Application of Planar Doppler Velocimetry within Piston Engine Cylinders. 11th International Symposium on Applications of Laser Techniques to Fluid Mechanics, Lisbon, 8-11 June 2002.. Volltext nicht online. |
| Willert, C. and Schodl, R. and Lempereur, C. and Barricau, P. (2003) Application of Planar Doppler Velocimetry(DGV) in Cryogenic Wind Tunnels. In: Minutes of the ONERA/DLR meeting-Test Methods. DLR-ONERA meeting,March 26-27,2003,Toulouse. Volltext nicht online. |
| Willert, C. and Stockhausen, G. and Beversdorff, M, and Klinner, J. and Lempereur, C. and Barricau, P. and Quest, J. and Jansen, U. (2004) Application of Doppler Global Velocimetry in Cryogenic Wind Tunnels. In: 12th Intl. Symposium - Applications of Laser Techniques to Fluid Mechanics (CD-ROM). 12th International Symposium on Applications of Laser Techniques to Fluid Mechanics, Lisboa (Portugal), 12.-15. Juli 2004. Volltext nicht online. |
| Willert, C. and Stockhausen, G. and Klinner, J. and Beversdorff, M. and Quest, J. and Jansen, U. and Raffel, M. (2003) On the development of Doppler global velocimetry for cryogenic wind tunnels. In: ICIASF 2003 Record, pp. 2-9. IEEE. 20th International Congress on Instrumentation in Aerospace Simulation Facilities (ICIASF), Göttingen, 25-29. Aug. 2003, -. ISBN 0-7803-8189-1. Volltext nicht online. |
| Willert, C. and Stockhausen, G. and Klinner, J. and Beversdorff, M. and Richard, H. and Raffel, M. and Quest, J. and Becker, W. (2003) On the development of planar laser velocimetry techniques fro cryogenic wind tunnels. In: CD ROM Proceedings PIV'03. 5th International Symposium on Particle Image Velocimetry, Pusan, Korea, 22-24. Sept. 2003, -. Volltext nicht online. |
| Willert, C. (2000) Feasibility study for the combination of PIV with Doppler global velocimetry (DGV). 3rd Workshop on Particle Image Velocimetry, 2000-07-07 - 2000-07-08, Lissabon, Portugal. Volltext nicht online. |
| Willert, C. and Blümcke, E. and Beversdorff, M. and Unger, W. (2000) Phasenaufgelöste Doppler Global Geschwindigkeitsmessungen im Abgaskrümmer eines 4 Zylinder Motors. In: Lasermethoden in der Strömungsmesstechnik, 8. Fachtagung, GALA, 20.1-20.7. Shaker Verlag. 8. Fachtagung der GALA, 2000-09-12 - 2000-09-14, Freising. ISBN 3826578090. Volltext nicht online. |
| Willert, Chris (2009) Advanced image analysis for particle image velocimetry. Part I: Processing individual PIV recordings. In: Lecture Series Monographs "Recent advances in particle image velocimetry", LS 2009-01. von Karman Institute for Fluid Mechanics. ISBN 978-2-930389-89-3. Volltext nicht online. |
| Willert, Christian (2006) Assessment of camera models for use in planar velocimetry calibration. Experiments in Fluids, 41 (1), pp. 135-143. doi: 10.1007/s00348-006-0165-2. Volltext nicht online. |
| Willert, Christian (2007) Planar imaging techniques in turbomachinery - Current status and future trends. Experimental Fluid Mechanics, Computer Vision & Pattern Recognition (Seminar 07121), 2007-03-18 - 2007-03-23, Schloss Dagstuhl, Wadern (Germany). Volltext nicht online. |
| Willert, Christian (2009) Advanced image analysis for particle image velocimetry. Part II: Ensemble-correlation methods. In: VKI Lecture Series Monographs "Recent advances in particle image velocimetry", LS 2009-01. von Karman Institute for Fluid Mechanics. ISBN 978-2-930389-89-3. Volltext nicht online. |
| Willert, Christian (2009) Recounting Twenty Years of Digital PIV, its Origins and Current Trends. 8th International Symposium on Particle Image Velocimetry (PIV09), 2009-08-25 - 2009-08-28, Melbourne, Australia. Volltext nicht online. |
| Willert, Christian and Gharib, Morteza and Kompenhans, Jürgen (2009) PIV Analysis of Prandtl's Flow Visualization Movies. 62nd Annual Meeting of the APS Division of Fluid Dynamics, 2009-11-22 - 2009-11-24, Minneapolis, MN, USA. Volltext nicht online. |
| Willert, Christian and Hassa, Christoph and Stockhausen, Guido and Jarius, Marc and Voges, Melanie and Klinner, Joachim (2006) Combined PIV and DGV applied to a pressurized gas turbine combustion facility. Measurement Science and Technology, 17 (7), pp. 1670-1679. doi: 10.1088/0957-0233/17/7/005. Volltext nicht online. |
| Willert, Christian and Stockhausen, Guido and Klinner, Joachim and Lempereur, Christine and Barricau, Philippe and Loiret, Philippe and Raynal, Jean Claude (2007) Performance and accuracy investigations of two Doppler global velocimetry systems applied in parallel. Measurement Science and Technology, 18 (8), pp. 2504-2512. Insitute of Physics (IOP) Publishing. doi: 10.1088/0957-0233/18/8/027. Volltext nicht online. |
| Willert, Christian and Stockhausen, Guido and Voges, Melanie and Klinner, Joachim and Schodl, Richard and Hassa, Christoph and Schürmanns, Bruno and Güthe, Felix (2008) Selected applications of planar imaging velocimetry in combustion test facilities. In: Particle Image Velocimetry. New Developments and Recent Applications Topics in Applied Physics, 112. Springer Verlag. pp. 283-309. ISBN 978-3-540-73527-4. Volltext nicht online. |
| Willert, Christian (2007) Planar Image Velocimetry in Combustion Facilities - Status and Challenges. 7th International Symposium on Particle Image Velocimetry (PIV2007), 2007-09-11 - 2007-09-14, Rome (Italy). Volltext nicht frei. |
| Willert, Christian (2008) Adaptive PIV processing based on ensemble correlation. 14th International Symposium on Applications of Laser Techniques to Fluid Mechanics, 2008-07-07 - 2008-07-10, Lisbon (Portugal). |
| Willert, Christian (2008) Potential of ensemble-correlation techniques for adaptive PIV processing. In: Conference Proceedings, Book o. EWA International Workshop on Advanced Measurement Techniques in Aerodynamics, 2008-03-31 - 2008-04-01, Delft (The Netherlands). Volltext nicht frei. |
| Willert, Christian (2009) On the transition of PIV into the digital age: Recounting 20 years of digital PIV. Symposium 25 Years of PIV in Aerodynamics, 2009-09-23 - 2009-09-25, Göttingen. Volltext nicht frei. |
| Willert, Christian and Freitag, Stefan and Hassa, Christoph (2008) High speed imaging of fuel sprays using a low-cost illumination source. 22nd European Conference on Liquid Atomization and Spray Systems (ILASS 2008), 2008-09-08 - 2008-09-10, Como Lake (Italy). Volltext nicht frei. |
| Willert, Christian and Heinze, Johannes and Klinner, Joachim and Stockhausen, Guido and Voges, Melanie (2008) Development and Application of Laser-Based Diagnostics for Combustion Research at DLR Cologne. 5th Australian Conference on Laser Diagnostics in Fluid Mechanics and Combustion, 2008-12-03 - 2008-12-04, Perth (Australia). Volltext nicht frei. |
| Willert, Christian and Moessner, Steffen and Freitag, Stefan and Hassa, Christoph (2010) High speed shadowgraphy of a combusting air blast atomizer spray at elevated pressure. 23rd Annual Conference on Liquid Atomization and Sprays, ILASS Europe 2010 (, 2010-09-06 - 2010-09-08, Brno, Czech Republic. Volltext nicht frei. |
| Willert, Christian and Mößner, Steffen and Klinner, Joachim (2009) Pulsed operation of high power light emitting diodes for flow velocimetry. 8th Internation Symposium on Particle Image Velocimetry (PIV09), 2009-08-25 - 2009-08-28, Melbourne, Australia. (In Press) |
| Willert, Christian and Mößner, Steffen and Klinner, Joachim and Freitag, Stefan (2009) Pulsed operation of high-power light emitting diodes (LED) for flow diagnostics. MOTAR Chapter 1: Advanced Measuring Techniques (DLR-ONERA Workshop), 2009-03-30 - 2009-03-31, Toulouse, Frankreich. Volltext nicht frei. |
| Willert, Christian and Stockhausen, Guido and Klinner, Joachim and Lempereur, Christine and Barricau, Philippe and Loiret, Philippe and Raynal, Jean-Claude (2006) Performance and accuracy investigations of two Doppler global velocimetry systems applied in parallel. 13th International Symposium on Applications of Laser Techniques to Fluid Mechanics, 2006-06-26 - 2006-06-29, Lissabon (Portugal). Volltext nicht frei. |
| Willert, Christian and Voges, Melanie and Stockhausen, Guido and Klinner, Joachim and Schodl, Richard and Hassa, Christoph and Schuermans, Bruno (2006) Selected applications of planar imaging velocimetry in combustion test facilities. PIVNET2 Final Workshop, 2006-09-07 - 2006-09-08, DLR, Göttingen (Germany). |
| Winterfeld, G. (1991) Scramjet-Technologieprogramm, 1. Phase. DLR-Interner Bericht. 325-08-91. 18 S. Volltext nicht online. |
| Winterfeld, G. and Kremer, F. G. J. (1994) Scramjet-Leistungsrechnungen. 10. Arbeitskreissitzung Antriebe, 03.11.93, München. Volltext nicht online. |
| Wolfrum, Nina and Bechlars, Patrick and Beck, Maximilian and Frey, Christian and Schlüß, Daniel (2020) On the Formulation of Nonreflecting Boundary Conditions for Turbomachinery Configurations. Part II: Application and Analysis. ASME Turbo Expo 2020: Turbomachinery Technical Conference and Exposition, GT 2020, 2020-06-22 - 2020-06-26, London, England. Volltext nicht online. |
| Wunderlich, Tobias and Abu-Zurayk, Mohammad and Ilic, Caslav and Jepsen, Jonas and Schulze, Matthias and Leitner, Martin and Schuster, Andreas and Dähne, Sascha and Petsch, Michael and Becker, Richard-Gregor and Zur, Sascha and Gottfried, Sebastian (2018) Overview of collaborative high performance computing-based MDO of transport aircraft in the DLR project VicToria. Deutscher Luft- und Raumfahrtkongress 2018, 2018-09-04 - 2018-09-06, Friedrichshafen, Germany. |
| Wurzel, D. and Neise, W. (2002) Quiet Traffic - A joint effort of industry, academia, and agencies to reduce transportation noise. In: Proceedings Internoise 2002 International Congress and Exposition on Noise Control Engineering. Internoise 2002 International Congress and Exposition on Noise Control Engineering, Dearborn, Michigan, USA, 19.-21 August 2002. Volltext nicht online. |
| Yamamoto, K. (NAL, Tokyo, Japan, Engel, K., (1997) Multi-Block Grid Generation Using an Elliptic Differential Equation. AIAA-Aerospace Sciences Meeting, Reno, USA, Januar 1997. Volltext nicht online. |
| Yamashita, Hiroshi and Grewe, Volker and Jöckel, Patrick and Linke, Florian and Schaefer, Martin and Sasaki, Daisuke (2016) Air traffic simulation in chemistry-climate model EMAC 2.41: AirTraf 1.0. Geoscientific Model Development, 9 (9), pp. 3363-3392. Copernicus Publications. doi: 10.5194/gmd-9-3363-2016. ISSN 1991-959X. |
| Yang, Hong and Nürnberger, Dirk and Kersken, Hans-Peter (2005) Towards Excellence in Turbomachinery CFD: A Hybrid Structured-Unstructured RANS Solver. Volltext nicht online. |
| Zachcial, a. and Eulitz, F. (2000) Modeling and Simulation of Transition Phenomena in unsteady Turbomachinery Flow. 9th International Symposium on Unsteady Aerodynamics, Aeroacoustics and Aeroelasticity of Turbomachines, École Centrale de Lyon, Lyon, France, 4-8 Sept., 2000. Volltext nicht online. |
| Zenkner, Sebastian and Becker, Richard-Gregor (2018) Preliminary Engine Design for the MULDICON Configuration. AIAA Aviation Forum, 2018-06-25 - 2018-06-29, Atlanta, Georgia, USA. doi: 10.2514/6.2018-3163. Volltext nicht online. |
| Zenkner, Sebastian and Becker, Richard-Gregor and Trost, Marco and Voß, Christian (2018) Beiträge zum Triebwerksentwurf einer agilen und hoch gepfeilten Nurflügelkonfiguration. DLRK 2018, 2018-09-04 - 2018-09-06, Friedrichshafen. doi: 10.25967/480208. |
| Zettler, D. (1996) Numerische Analyse der instationaeren Stoemung einer mehrstufigen Turbine zur Untersuchung des Clocking-Effektes. Other. 100 S. Volltext nicht online. |
| Zhao, X. and Krain, H. (1989) Die Berechnung der Transsonischen Strömung auf S1 und S2-Flächen in Radialverdichtern mit Hilfe des Stromfunktionsverfahrens. Project Report, DLR-Interner Bericht. 325-05-89. 37 S. Volltext nicht online. |
| Zhao, X. and Krain, H. (1990) Grenzschichtberechnung in transsonischer Stroemung unter Beruecksichtigung von Stoss-/Grenzschicht-Interferenzen. DLR-Interner Bericht. 325-08-90. 19 S. Volltext nicht online. |
| Zhao, X. and Krain, H. (1995) A Quasi Three-Dimensional Calculation System for Transonic Centrifugal Compressor Impeller Design and Analysis. In: Proc. 12th Int. Symp. on Air Breathing Engines (ISABE), Sept. 10- 15, 1995, Melbourne, Vol. 1, pp. 125-133, pp. 125-133. AIAA, 370 L'Enfant Promenade, SW Washington, DC, 20024-2518. 12th International Symp. on Air Breathing Engines (ISABE), Sept. 10- 15, 1995, Melbourne, Australia. Volltext nicht online. |
| Ziemann, E. and R. Schodl), (1992) Konzeption eines signaloptimierten Laser-Zwei-Fokus-Geschwindigkeitsmeßgerätes auf Laserdiodenbasis. Diploma, SM-AT. Volltext nicht online. |
| Zimmerling, G. (1995) Experimentelle und theoretische Untersuchungen zur Optimierung eines Überschalldiffusors mit Keilstoßgenerator. Diploma, Bergische Universität GHS Wuppertal. Volltext nicht online. |
| de Martel, E. (2002) Etalonnage d'une quadruple prise de pression totale et de deux sondes pneumatiques à trois trous en domaine subsonique. DLR-Interner Bericht. 225-2002 A 01. 43 S. Volltext nicht online. |
