DLR-Logo -> http://www.dlr.de
DLR Portal Home | Impressum | Datenschutz | Kontakt | English
Schriftgröße: [-] Text [+]

Einträge mit Themengebiet "Institut für Antriebstechnik"

Eine Ebene höher
Exportieren als [feed] Atom [feed] RSS 1.0 [feed] RSS 2.0
Springen zu: A | B | C | D | E | F | G | H | I | J | K | L | M | N | O | P | R | S | T | U | V | W | Y | Z
Anzahl der Einträge auf dieser Ebene: 1515.


  Achterberg, K. (1991) Untersuchungen zur Auslegung eines Überschalldiffusors für einen Schubdüsenprüfstand. Diplomarbeit, RWTH Aachen. Volltext nicht online.

  Alrutz, Thomas und Aumann, Petra und Basermann, Achim und Feldhoff, Kim und Gerhold, Thomas und Hunger, Jörg und Jägersküpper, Jens und Kersken, Hans-Peter und Knobloch, Olaf und Kroll, Norbert und Krzikalla, Olaf und Kügeler, Edmund und Müller-Pfefferkorn, Ralph und Puetz, Mathias und Schreiber, Andreas und Simmendinger, Christian und Voigt, Christian und Zscherp, Carsten (2009) HICFD – Hocheffiziente Implementierung von CFD-Codes für HPC-Many-Core-Architekturen. In: PARS-Mitteilungen (ISSN 0177-0454), 26, Seiten 27-35. 22. PARS-Workshop, 04.-05. Juni 2009, Parsberg in der Oberpfalz, Deutschland. ISSN ISSN 0177-0454 file

  Amecke, J. (2001) Kalibrierung von zwei Temperatursonden. DLR-Interner Bericht. 225-2001 C 06, 16 S. Volltext nicht online.

  Amecke, J. (2002) Vorüberlegungen für einen neuen Turbinenprüfstand im DLR. DLR-Interner Bericht. 225-2002 A 04, 47 S. Volltext nicht online.

  Amecke, J. (2002) Vorbereitung des KWU-Gitterkanals für Messungen mit Überschallzuströmgeschwindigkeiten. DLR-Interner Bericht. 225-2002 C 07, 25 S. Volltext nicht online.

  Amecke, J. (2004) Neues Forschungsprogramm für Kondensation in Dampfturbinen. DLR-Interner Bericht. 225 - 2004 A 10, 50 S. Volltext nicht online.

  Ardey, S. und Fottner, L. und Beversdorff, M. und Weyer, H. (1997) Laser-2-Focus Measurements on a Turbine Cascade with Leading Edge Film Cooling. In: Proc. 90th Symp. of AGARD-PEP on "Advanced Non-intrusive Instrumentation for Propulsion Engines" 1997. 90th Symp. of AGARD-PEP on "Advanced Non-intrusive Instrumentation for Propulsion Engines", Oct. 20-24, Brüssel, 1997. Volltext nicht online.

  Ardey, S. und Langowsky, C. und Fottner, L. (1997) Aerodynamische Mischungsanalyse filmgekühlter Turbinenschaufelgitter. DGLR-JT-97-155, DGLR-Jahrestagung, Okt. 1997, München. Volltext nicht online.

  Arnold, F. und Hahn, J. und Michalke, A. und Neise, W. (1995) Zur Schalleistungsmessung in Strömungskanälen mit Schlitzrohrsonden. In: Fortschritte der Akustik - DAGA '95, Seiten 531-534. DPG GmbH, Bad Honnef. DAGA '95, Saarbrücken, 14.-17.03.1995. Volltext nicht online.

  Arnold, F. und Hahn, J. und Michalke, A. und Neise, W. (1996) Berechnung neuer Korrekturwerte für die Schalleistungsmessung nach dem Kanal-Verfahren DIN EN 25136. DLR-Interner Bericht. 92517-96/B2, 23 S. Volltext nicht online.

  Arold, M. (1995) Experimental Investigation of instationary dispersion Characteristics of a flatsheet atomizer. DLR-Interner Bericht. Volltext nicht online.

  Ashcroft, G. und Schultz, J. (2004) Numerical Modelling of Wake-Jet Interaction with Application to Active Noise Control in Turbomachinery. 10th AIAA/CEAS Aeroacoustics Conference, Manchester UK, 10.05.04. Volltext nicht online.

  Ashcroft, G. und Schulz, J. (2004) Numerical modelling of wake-jet interaction with application to active noise control in turbomachinery. In: Proceedings CFA/DAGA04, Seiten 823-824. CFA/DAGA 04, März 2004, Straßburg, Straßburg. Volltext nicht online.

  Ashcroft, G. und Schulz, J. (2004) Numerical modelling of wake-jet interaction with application to active noise control in turbomachinery. In: Proceedings 10th AIAA/CEAS Aeroacoustics Conference. 10th AIAA/CEAS Aeroacoustics Conference, Manchester, England, 10. - 12. May 2004. Volltext nicht online.

  Ashcroft, G. und Schulz, J. (2004) Numerical Modelling of Wake-Jet Interaction with Application to Active Noise Control. CFA/DAGA Joint Congress, Strasbourg, 22.-25.3.2004, Strasbourg. Volltext nicht online.


  Backhaus, Jan und Engels-Putzka, Anna und Frey, Christian (2016) a code-coupling approach to the implementation of discrete adjoint solvers based on automatic differentiation. VII European Congress on Computational Methods in Applied Sciences and Engineering, ECCOMAS Congress 2016, 5.-10. Jun. 2016, Kreta, Griechenland. Volltext nicht online.

  Balling, Lothar und Wiedermann, Alexander und Braun, Jost und Rossig-Kruska, Frank und Dibelius, Günther und Mönig, Reinhard und Waltke, Ulrich und Bals, Herbert F.J. und Vogeler, Konrad und Sattelmayer, Thomas und Krebs, Werner und Hellat, Jaan und Eroglu, Adnan und Deuker, Eberhard und Kroll, Wolfgang und Heilos, Andreas und Huth, Michael und Karg, Jürgen und Waldinger, Roger und Köller, Ulf D. und van den Toorn, Bernd und Bolms, Hans-Thomas und Reichert, Arnd W. und Weigand, Bernhard und Schulte, Joachim und Müller, Michael und Janssen , Manfred und Maldfeld, Ekkehard und Verstege, Stefan und Böckel, Frank und Grote, Holger und Taut, Christine und Kollenberg, Wolfgang und Rettig, Uwe und Czech, Norbert und Berger, Christina und Grünling, Hermann W. und Becker, Bernhard und Paschmann, Willi und Wegen, Michael und Wutsdorff, Peter und Werner, Klaus und König, Olaf und Lechner, Christof und Stefan, L.F. Frank und Woditschka, Frank und Bauer, Andreas und Rofka, Stefan und Drobner, Olaf und Pahl, Andreas und Brummel, Hans-Gerd und Inceoglu, Ayhan und Bohrenkämper, Gerhard und Steinwachs, Christopher (2010) Stationäre Gasturbinen 2., neu bearbeitete Auflage. In: Stationäre Gasturbinen Spinger Verlag Berlin; Heidelberg . Seiten 1-1120. ISBN 978-3-540-92787-7 // e-ISBN 978-3-540-92788-4 . Volltext nicht online.

  Bannasch, R. und Bechert, D. W. (1995) Boundary Layer Effects Subjected to Multiple Curvatures and Pressure Gradients in Fast Swimming Animals. Euromech Colloquium 332 "Drag Reduction"; 9th European Drag Reduction Meeting, Ravello/Italy, 19-21 April 1995. Volltext nicht online.

  Barricau, P. und Lempereur, C. und Mignosi, A. und Mathé, J.-M. und Roehle, I. und Schodl, R. und Willert, C. (2001) ONERA/DLR activities on Doppler global velocimetry and its qualification for wind tunner applications. Proceedings: 3th ONERA/DLR Aerospace Symposium, Paris, France, 20-22 June 2001.. Volltext nicht online.

  Barsikow, B. (1) und King III, W. F. (1996) Acoustical investigations of a full-scale DSA-350-SEK pantograph in an anechoic open-jet wind tunnel. DLR-Interner Bericht. Technical Document 1A 6G09 T1.DZ, Deutsch-Französische Kooperation, Anhang K2 (1996).. Volltext nicht online.

  Bartenwerfer, M. und Neise, W. (1995) FANCET - Ein Computerprogramm zur Berechnung von Ventilatorgeräuschpegeln und -spektren aus Modellmessungen. In: Fortschritte der Akustik - DAGA '95, Seiten 559-562. DPG GmbH, Bad Honnef. DAGA `95, Saarbrücken, 14.-17.03.1995. Volltext nicht online.

  Bartenwerfer, M. und Neise, W. (1995) FANCET - a method and a computer program based on acoustic similarity to predict fan noise levels and spectra using model fan noise data. In: Proceedings Euro-noise '95, CETIM (1995), Seiten 893-898. Euro-noise `95, Lyon, 21-23 March 1995. Volltext nicht online.

  Bartenwerfer, M. und Neise, W. (1995) FANCET - eine Methode und ein Rechenprogramm zur Berechnung von Ventilatorgeraeuschpegeln und -spektren aus Messungen an Modellen. DLR-Interner Bericht. 92517-95/B1, 69 S. Volltext nicht online.

  Basermann, Achim und Kersken, Hans-Peter (2009) Parallel Iterative Solvers for Block-Structured CFD Problems. 38th SPEEDUP Workshop on High-Performance Computing, 07.-08. Sept. 2009, Lausanne, Schweiz. file

  Basermann, Achim und Kersken, Hans-Peter und Frey, Christian (2010) Parallele Gleichungslöser für die linearen TRACE-Module. Software-Innovationen für die Luftfahrtforschung, 19.-20. April 2010, Braunschweig, Deutschland. file

  Baumann, W. W. und Thiele, F. (1990) Heat and Mass Transfer in Evaporating Two-Component Liquid Film Flow. Int. J. Heat and Mass Transfer 33, Seiten 267-273. Volltext nicht online.

  Baumann, W. W. und Thiele, F. (1990) Effect of Phase Equilibrium on the Interfacial Transfer Behavior in Evaporating Two-Component Liquid Film Flow. In: Proceedings Advances in Gas-Liquid Flows, Seiten 389-396. Advances in Gas-Liquid Flows, 25-30 November 1990, Dallas, USA. Volltext nicht online.

  Bechert, D. und Bruse, M. und Hage, W. und van der Hoeven, J.G.T. und Hoppe, G. (1997) Experiments on drag-reducing surfaces and their optimization with an adjustable geometry. Journal of Fluid Mechanics (338), Seiten 59-87. Volltext nicht online.

  Bechert, D. W. (1995) Calibration of Preston Tubes. AIAA Journal, Vol. 33 (12). Volltext nicht online.

  Bechert, D. W. (1995) Künstliche Haifischhaut-Optimierung im Labor und in der Natur. Seminar "Bionik - Von der Natur lernen - naturgemäß handeln", Hamburg, 22. Juni 1995. Volltext nicht online.

  Bechert, D. W. (1995) Überlegungen zur Verlustminderung in Strömungsmaschinen. Seminar am DLR-Institut für Antriebstechnik, Köln, 23. Januar 1995. Volltext nicht online.

  Bechert, D. W. (1996) Reibungsarme Oberfläche, Modell Hai. In: Bionik, Zukunftstechnik lernt von der Natur Landesmuseum für Technik und Arbeit, Mannheim 1996, S. 30-31, 4 Bild.. Volltext nicht online.

  Bechert, D. W. (1996) Calibration of Preston tubes. AIAA Journal Vol. 34 (1996) No. 1, 205-206. Volltext nicht online.

  Bechert, D. W. (1996) Methoden der Widerstands-Reduktion. Seminar für Luft- und Raumfahrt, TU Berlin, 28.6.1996. Volltext nicht online.

  Bechert, D. W. (1996) Vortex-Generatoren auf Windenergieanlagen. Strategiegespräch Geräuschminderung von Windenergieanlagen, Erfurt, 5.-6.2.1996. Volltext nicht online.

  Bechert, D. W. (1996) Rückstrombremsen als Hochauftriebshilfen. DASA-Airbus, Bremen, 20.11.1996. Volltext nicht online.

  Bechert, D. W. (1996) Turbulenzbeeinflussung zur Widerstandsverminderung. DLR-Interner Bericht. Internes Handout, DLR Berlin (1996), 6 S. Volltext nicht online.

  Bechert, D. W. (1996) Rückstrombremsen. DLR-Interner Bericht. Internes Handout, DLR Berlin/TU Berlin, 4 S. Volltext nicht online.

  Bechert, D. W. und Bruse, M. und Hage, W. (1996) VW-Stiftungsvorhaben I/69667+69668; Einige Aspekte der strömungsmechanischen Widerstandsverminderung in der Biologie. Projektteil: Verminderung der Wandreibung. Zwischenbericht 1995/96. DLR-Interner Bericht. 92517-96/B5, 28 S. Volltext nicht online.

  Bechert, D. W. und Hage, W. und Bruse, M. (1995) Drag Reduction with the Slip Wall. AIAA Journal, Vol. 34 (2). Volltext nicht online.

  Bechert, D. W. und Hage, W. und Bruse, M. (1996) Drag reduction with the slip wall. AIAA Journal, Vol. 34 (5), Seiten 1072-1074. Volltext nicht online.

  Bechert, D. W. und Meyer, R. und Hage, W. (1996) BMBF-Vorhaben 13N6537-8. Aeroflexible Oberflächenklappen als "Rückstrombremsen" nach dem Vorbild der Deckfedern des Vogelflügels. Zwischenbericht 1995. DLR-Interner Bericht. 92517-96/B12, 22 S. Volltext nicht online.

  Bechert, D.W. (1997) On Loss reduction in axial turbomachines. Airforce Aero Propulsion Lab., Wright-Patterson AFB, Dayton, Ohio, USA, 7.7.1997. Volltext nicht online.

  Bechert, D.W. (1997) Biological Surfaces - Laboratory and flight experiments on drag reduction and separation control. University of Southern California, Los Angeles, USA, 20.11.97. Volltext nicht online.

  Bechert, D.W. und Bruse, M. und Hage, W. und Meyer, R. (1997) Biological surfaces and their technological application - laboratory and flight experiments on drag reduction and separation control. Invited Lecture. 4th AIAA Shear Flow Conference, 29.6.1997-2.7.1997, Snowmass Village, Co, USA. Volltext nicht online.

  Bechert, D.W. und Bruse, M. und Meyer, R. (1997) Einige Aspekte der strömungsmechanischen Widerstandsverminderung in der Biologie. VW-Stiftung, Zwischenbericht 1996/97. DLR-Interner Bericht. 92517-97/B7, 12 S. Volltext nicht online.

  Becker, J. (1999) Plain jet in crossflow at elevated pressure without and with filmer plate. Projektbericht, DLR-Interner Bericht. 325-01-99. Volltext nicht online.

  Becker, J. (2000) Dispersion of a Plain Jet Spray of Kerosene in an Annular Swirling Air Flow at Elevated Temperature and Pressure. Projektbericht, DLR-Interner Bericht. 325-02-2000, 86 S. Volltext nicht online.

  Becker, J. (2003) Characterization of the temporal and spatial homogeneity of the fuel placement in a swirl cup: Non-reacting flow investigation by light sheet imaging, LDA and PDA. Projektbericht, DLR-Interner Bericht. 325-03-03, 67 S. Volltext nicht online.

  Becker, J. und Hassa, C. (1999) Breakup and Atomization of a Kerosene Jet in Crossflow of Air at Elevated Pressure. ILASS Europe 99, Proceedings 15th Annual Conference on Liquid Atomization and Spray Systems, Toulouse, Frankreich, 5.-7. Juli 1999. Volltext nicht online.

  Becker, J. und Hassa, C. (2001) Messung des turbulenten Längenmaßes in einem generischen Vormischmodul für Flugtriebwerke. In: Lasermethoden in der Strömungsmesstechnik, 25.1-25.7. Shaker Verlag, Aachen. 9. Fachtagung in der Strömungsmesstechnik, GALA 2001, Winterthur, 18.-20. Sept. 2001. Volltext nicht online.

  Becker, J. und Hassa, C. (2000) Plain Jet Kerosene Injection Into High Temperature, High Pressure Crossflow With And Without Filmer Plate. 8th International Conference on Liquid Atomization and Spray Systems, ICLASS-2000, Pasadena, USA, 16-20 July, 2000. Volltext nicht online.

  Becker, J. und Hassa, C. (2002) Breakup and atomization of a kerosene jet in crossflow at elevated pressure. Atomization and Sprays, 12 (1-3), Seiten 49-67. Volltext nicht online.

  Becker, J. und Hassa, C. (2003) Liquid fuel placement and mixing of generic aeroengine premix module at different operating conditions. Journal of Engineering for Gas Turbines and Power, 125 (4), Seiten 901-908. Volltext nicht online.

  Becker, J. und Hassa, C. (2002) Liquid fuel placement and mixing of a generic aeroengine premix module at different operating conditions, paper number GT-2002-30102. In: 2002 ASME Turbo Expo, June 3-6, 2002, Amsterdam, The Netherlands. ASME Turbo Expo 2002, Amsterdam, 3.-6. Juni 2002. Volltext nicht online.

  Becker, J. und Heitz, D. und Hassa, C. (2001) Spray Dispersion in a Counter-Swirling Double Annular Airflow at Gas Turbine Conditions. 17th Annual Conference on Liquid Atomization and Spray Systems, ILASS-Europe 2001, Zürich, 2.-6. Sept. 2001. Volltext nicht online.

  Becker, J. und Heitz, D. und Hassa, C. (2004) Spray dispersion in a counter-swirling double-annular airflow at gas turbine conditions. Atomization and Sprays, 14 (1), Seiten 15-35. Volltext nicht online.

  Becker, J. und Jarius, M. (2003) Validation rig geometry and operating and boundary conditions. Projektbericht. WP4-DLR-12M. Volltext nicht online.

  Becker, J, und Hassa, C, (2004) GT2004-53524 Experimental investigation of spatial and temporal aspects of the liquid fuel placement in a swirl cup at elevated pressure. In: Proceedings of ASME Turbo Expo 2004, Power for Land, Sea and Air, June 14-17, 2004, Vienna, Austria. ASME Turbo Expo, Wien, 14.-17. Juni 2004, Wien, Österreich. ISBN 0-7918-3739-4 Volltext nicht online.

  Behrendt, T. (1998) Kraftstoffaufbereitung. Kolloquium Triebwerkstechnologie, Bonn, 10.12.1998. Volltext nicht online.

  Behrendt, T. (2003) Strömung und Verbrennung in einem neuen Düsenkonzept für die magere Vormischverbrennung in Fluggasturbinen. Dissertation. DLR-Forschungsbericht. 14, 145 S. Volltext nicht online.

  Behrendt, T. (2004) Einsatzmöglichkeiten und Nutzen keramischer Brennkammerwände in Flugtriebwerken. DLR Werkstoff-Kolloquium, DLR Köln-Porz, 07.12.04. Volltext nicht online.

  Behrendt, T. und Frodermann, M. und Hassa, C. und Heinze, J. und Lehmann, und Stursberg, K. (1999) KEROMIX-stabile, schadstoffarme Magerverbrennung. Vorhaben: Druckeinfluss auf die magere Stabilitätsgrenze. KEROMIX Abschlusskolloquium, Köln, 8. Juni 1999. Volltext nicht online.

  Behrendt, T. und Frodermann, M. und Hassa, C. und Heinze, J. und Lehmann, und Stursberg, K. (1999) Optical Measurements of Spray Combustion in a Single Sector Combustor from a Practical Fuel Injector at Higher Pressures. Symposium on Gas Turbine Engine Combustion, Emissions and Alternative Fuels, Lisboa, Portugal, 12.-16. Okt. 99. Volltext nicht online.

  Behrendt, T. und Hassa, C. (1996) Ein Pruefstand zur Untersuchung von Zerstaeuber-Duesen fuer Gasturbinen. In: Proc. Spray 96, 2. Workshop über Sprays, Erfassung von Sprühvorgängen und Techniken der Fluidzerstäubung, Bremen, 4.-5.6.96, 1, 1-. Spray 96, 2.Workshop über Sprays, Erfassung von Sprühvorgängen und Techniken der Fluidzerstäubung, 4.-5. Juni 1996, Uni Bremen. Volltext nicht online.

  Behrendt, T. und Hassa, C. (1997) Untersuchung der Spraydynamik einer Einspritzduese fuer Fluggasturbinen unter atmosphaerischen und simulierten Druckbedingungen. In: Proc. 3. Workshop über Sprays, Erfassung von Sprühvorgängen und Techniken der Fluidzerstäubung (1997). 3. Workshop über Sprays, Erfassung von Sprühvorgängen und Techniken der Fluidzerstäubung, Hrsg. Koschel, Haidn, ISBN 3891000294. Volltext nicht online.

  Behrendt, T. und Hassa, C. (1997) Investigation of the spray dynamics of aeroengine fuel injectors under atmospheric and simulated pressure conditions. 90. AGARD-PEP Symposium, Bruessel, Belgien, 1997. Volltext nicht online.

  Behrendt, T. und Hassa, C. und Heinze, J. und Stursberg, K. (1999) Druckeinfluss auf die magere Stabilitätsgrenze. DLR-Interner Bericht. 325-08-99, 68 S. Volltext nicht online.

  Behrendt, T. und Heinze, J. und Hassa, C. (2000) Optical measurements of the reacting two-phase flow in a realistic combustor at elevated pressures. In: 16th annual Conference on liquid Atomization and Spray Systems, IV4.1-IV.4.6. ILASS-Europe 2000, Darmstadt, 11.-13.Sept.2000. Volltext nicht online.

  Behrendt, T. und Heinze, J. und Hassa, Ch. (2003) EXPERIMENTAL INVESTIGATION OF A NEW LPP INJECTOR CONCEPT FOR AERO ENGINES AT ELEVATED PRESSURES. In: Proc. of ASME Turbo Expo 2003, ISBN 0-7918-3671-1 Proc. of ASME Turbo Expo. ISBN 0-7918-3671-1. Volltext nicht online.

  Berg, H.P. und Hennecke, D.K. und Elfert, M. und Hein, O. (1991) The effect of rotation on local coolant side flow and heat transfer in turbine blades. In: ISABE-Paper 91-7016, Vol. 1, Seiten 170-183. AIAA, American Institute of Aeronautics and Astronautics, Washington. Proceedings of the 10th International Symposium on Air Breathing Engines (ISABE), Nottingham (UK), 01.-06.09.1991. ISBN 1-56347-006-3 Volltext nicht online.

  Beversdorff, M. und Foerster, W. und Clauss, W. und Waidmann, W. und Woyde, M. (1997) Velocity and Temperature Measurements in a Scramjet Combustion Chamber. In: Proc. XIII Int. Symp. on Air Breathing Engines (ISABE) 1997. XIII International Symposium on Air Breathing Engines (ISOABE). Volltext nicht online.

  Beversdorff, M. und Foerster, W. und Rymenants, E. und Schodl, R. (1994) Laser Two Focus Velocimetry Applied to TsAGI's Supersonic Combustor Test Rig T131. DLR-Interner Bericht. 325-07-94. Volltext nicht online.

  Beversdorff, M. und Foerster, W. und Schodl, R. (1994) Inflight measurements in a Citation Airplane with a Diode-L2F. DLR-ONERA-Messtechni-Kooperation, Treffen in Lampoldshausen. Volltext nicht online.

  Beversdorff, M. und Foerster, W. und Schodl, R. und Jentink, H.W. (NLR) (1997) In-flight Laser Anemometry for Aerodynamic Investigations on an Aircraft. OPTICS and LASERS in Engineering, 6, Seiten 571-586. Elsevier, Northern Ireland. Volltext nicht online.

  Beversdorff, M. und Förster, W. und Schodl, R. und Jentink, H.W. (1998) Laser-Anemometrie im Flugversuch. 1. Braunschweiger Symposium für Flugmeßtechnik des SFB 420, TU Braunschweig, 31.03.-01.04.1998. Volltext nicht online.

  Beversdorff, M. und Förster, W. und Schodl, R. und Jentink, H.W. (1998) Laser Anemometrie im Flugversuch. 1. Braunschweiger Symposium für Flugmesstechnik, SFB 420,Uni Braunschweig, 31.03.-01.04.1998. Volltext nicht online.

  Beversdorff, M. und Klemmer, T. und Rymenants, E. und Schodl, R. (1994) L2F-Geschwindigkeitsmessungen am Austritt einer H2-luftbetriebenen Brennkammer. DLR-Interner Bericht. 325-05-94. Volltext nicht online.

  Beversdorff, M. und Matziol, L. und Blaha, C. (1997) Application of 3D-Laser Two Focus Velocimetry in Turbomachine Investigations. 90th Symposium of AGARD-PEP on "Advanced non-intrusive Instrumentation for Propulsion Engines, Oct. 20-24, Bruessel, 1997. Volltext nicht online.

  Beversdorff, M. und Heinrich, R. und Schodl, R. (1992) An L2F-Measurement Device with Image Rotator Prism for Flow Velocity Analysis in Rotating Coolant Channels. In: AGARD-PEP. 80th Symposium of the PEP on "Heat Transfer and Cooling in Gas Turbines", 12.-16.10.1992, Antalya, Turkey. Volltext nicht online.

  Bhayaraju, U. und Giuliani, F. und Hassa, C. (2004) Study of Prefilming Airblast Atomisation at High Pressure Conditions. DLR/ONERA Annex II Meeting, Köln, 6.-7. 4. 2004,. Volltext nicht online.

  Blandeau, V. und Pastorelli, V. und Moreau, A. und Guérin, S. (2015) Fan noise scaling of static data using semi-analytical methods and assessment against experimental data. 21st AIAA/CEAS Aeroacoustics Conference, AVIATION 2015, 2015, Dallas. Volltext nicht online.

  Bluemcke, E. und Brandt, M. und Eickhoff, H. (1991) Particle Dispersion in Highly Swirling Turbulent Flows. Eighth Symposium on turbulent shear flows, 9.-11.09.1991 Technische Universität München. Volltext nicht online.

  Bluemcke, E. und Brandt, M. und Eickhoff, H. und Hassa, Ch. (1992) Experimental and Theoretical Investigation of a Research Atomizer Combustion Chamber Configuration. In: ASME International Gas Turbine Conference 1992, paper 137. ASME, New York, USA. Volltext nicht online.

  Bluemcke, E. und Brandt, M. und Eickhoff, H. und Hassa, Ch. (1993) Validation Experiments for Dispersed Phase Modelling in Combusting Flows. 6th Workshop on Two-Phase-Flow Predictions, edition M. Sommerfeld. Volltext nicht online.

  Blümcke, E. (1990) Simulation der turbulenten Partikeldispersion in brennkammertypischen Drallströmungen. Kolloquium Energietechnik, Ruhr-Universität Bochum, 1990. Volltext nicht online.

  Blümcke, E. und Brandt, M. und Eickhoff, H. und Hassa, C. (1993) Particle Dispersion in Highly Swirling Turbulent Flows. Particle and Particle System Characterization, 10, Seiten 182-190. Volltext nicht online.

  Blümcke, E. und Eickhoff, H. und Hassa, C. (1990) Evaluation of a Spectral Dispersion Model with Experimental Results. 5th Workshop on 2 Phase-Flow Predictions, Universitaet Erlangen, March 1990.. Volltext nicht online.

  Blümcke, E. und Eickhoff, H. und Hassa, C. (1990) Evaluation of a Spectral Dispersion Model with Experimental Results Obtained from the Dispersion of Monosized Droplets in a Turbulent Swirling Flow. In: Proceedings of the 5th Workshop on Two-Phase Flow Predictions. 5th Workshop on Two-Phase Flow Predictions, 1990. Volltext nicht online.

  Blümcke, W. (1992) Turbulente Partikeldispersion in eingeschlossenen Drallströmungen. Dissertation. DLR-Forschungsbericht. 92-32, 178 S. Volltext nicht online.

  Boetzer, Michael (2011) Experimentelle Untersuchungen des Strömungsfeldes einer HDT-Stufe zum Einfluss von beschädigten Statorschaufeln auf den Stufenwirkungsgrad. Diplomarbeit. DLR-Interner Bericht. DLR-IB 225 - 2011 C 04, 89 S. Volltext nicht online.

  Bosen, S. (1991) Experimentelle Erprobung von Flüssigkristallbeschichtungen zur Untersuchung des Grenzschichtumschlages auf der Oberfläche transsonischer Verdichterprofile. DLR-Interner Bericht. 325-05-91, 115 S. Volltext nicht online.

  Brabender, F. (1991) Strömungsmessung mit Hilfe eines Laser-Anemometers in einem rotierenden Modellkanal. DLR-Interner Bericht. 325-03-91, 98 S. Volltext nicht online.

  Brandt, M. (1990) Messung der Geschwindigkeit, Konzentration und Ankunftszeitenverteilung monodisperser Tropfen in einer turbulenten Drallstroemung mit der Laser-Doppler-Anemometrie. Diplomarbeit. Volltext nicht online.

  Brandt, M. (1994) First Measurements on an Evaporating Spray at Elevated Pressure. Vortrag am 9. Juni 1994, Universitaet Patras, Griechenland, innerhalb des BRITE/EURAM-Low Emissions Combustor Technology Programme-Phase II. Volltext nicht online.

  Brandt, M. (1995) Two Phase Flow in Rectangular High Pressure Duct. Vortrag am 06.12.1994, Universitaet Karlsruhe innerhalb des BRITE/ EURAM - Low Emissions Combustor Technology Programme-Phase II. Volltext nicht online.

  Brandt, M. (1995) The Influence of Air Pressure, Temperature and Fuel Loading Ratio an Liquid Fuel Evaporation. Brite/Euram-Low Emission Combustor Technology Program-Phase II, ENSMA-Futoroscope Poitiers, Frankreich, 14.06.1995. Volltext nicht online.

  Brandt, M. (1995) Messung der Zwei-Phasen-Stroemung in einer Oelmischvorstrecke. Vortrag am 10.03.95, Hotel du Porc, Baden, Schweiz, innerhalb des Arbeitskreises TURBOFLAM. Volltext nicht online.

  Brandt, M. (1995) Liquid and Gaseous Fuel Measurements in a Premix Duct. In: Proc. of the 11th European Conference of ILASS Europe on Atomization and Sprays, Nürnberg 1995, Seiten 33-42. Nürnberg Messe GmbH. European Conference of ILASS Europe on Atomization and Sprays, Nürnberg 1995. ISBN 3-921590-34-5 Volltext nicht online.

  Brandt, M. (1995) Messung der Zwei-Phasen Stroemung in einer Oelmischvorstrecke. Vortrag in der AG-Turbo TURBOFLAM am 25. Okt. 1995, DLR, Koeln-Porz. Volltext nicht online.

  Brandt, M. (1996) The task summary of the DLR in Theme III: Focused Generics. Vortrag in Villa Roche, Frankreich, 6.02.1996 im Rahmen des CEC Low Emissions Technology Programme : Low NOx III. Volltext nicht online.

  Brandt, M. (1995) The Influence of Turbulence Generators on Liquid Fuel Evaporation in a Premix Duct. Dahlewitz (BMW-RR), 12. Dez. 1995 im Rahmen des CEC-Brite Euram Low Emissions Combustor Technology-Phase II. Volltext nicht online.

  Brandt, M. (1996) Messung der Zwei-Phasen Stroemung in einer Oelmischvorstrecke (III). Vortrag AG Turbo TURBOFLAM, Arbeitskreissitzung am 27.03.96, Muelheim, Siemens-KWU. Volltext nicht online.

  Brandt, M. (1996) Two-Phase Flow in Rectangular High Pressure Ducts. Final Report. Vortrag am 14.05.96, Rolls-Royce, Derby UK, innerhalb BRITE EURAM. Volltext nicht online.

  Brandt, M. (1996) Experimentelle Untersuchung der Zwei-Phasen-Strömung in einem Vormischkanal für die magere vorverdampfte Verbrennung. Vortrag am 27.11.96 im Kolloquium Energietechnik der Ruhr-Universität Bochum. Volltext nicht online.

  Brandt, M. und Eickhoff, H. und Hassa, Ch. (1992) An Experimental Study of Spray-Gasphase Interaction for a Co-Swirling Airblast Atomizer. In: 8th Annual Conference of the European ILASS, Seiten 115-122. Shell, Amsterdam, Netherlands. Volltext nicht online.

  Brandt, M. und Gugel, K.O. und Hassa, C. (1997) Experimental Investigation of the Liquid fuel Evaporation in a Premix Duct for Lean Premixed and Prevaporized Combustion. Trans. ASME, 5. Eng. Gas Turbines and Power, 119. Volltext nicht online.

  Brandt, M. und Gugel, K.O. und Hassa, C. (1997) Experimental Investigation of the Liquid Fuel Evaporation in a Premix Duct for Lean Premixed and Prevaporized Combustion. Journal of Engineering for Gas Turbines and Power, 119, Seiten 815-821. Volltext nicht online.

  Brandt, M. und Hassa, C. (1994) Messung der Zweiphasenströmung in einer Ölmischvorstrecke. Turboflam Arbeitskreissitzung Dresden, 06.10.1994. Volltext nicht online.

  Brandt, M. und Hassa, C. (1996) Task 2.1.5 "Two Phase Flow in High Pressure Duct". Projektbericht, DLR-Interner Bericht. BRITE/EURAM 'Low Emissions Combustor Technology' Phase II, Subtask 2.15, Final Report CEL Contract No.: AERO-Ctal-0036, 63 S. DLR. Volltext nicht online.

  Brandt, M. und Hassa, C. (1996) Modification of High Pressure Rig for Air-Fuel Mixing Experiments. Minutes of Expert Group Meeting "Focused Generic Combustion" BRITE/ EURAM Low Emissions Combustion III. Volltext nicht online.

  Brandt, M. und Hassa, C. (1996) Two Phase Flow in High Pressure Duct. Projektbericht, DLR-Interner Bericht. Volltext nicht online.

  Brandt, M. und Hassa, C. und Kallergis, K. und Eickhoff, K. (1994) An Experimental Study of Fuel Injectors for Premixing Ducts. Begell House, Inc., 79 Madison Avenue, NY 10016, USA. Proceedings of the 6th International Conference on Liquid Atomization and Spray Systems, ICLASS 1994, July 19-22, 1994 Rouen. Volltext nicht online.

  Brandt, M. und Hassa, C. und Rachner, M. (1997) Messung der Zwei-Phasen-Strömung (Tropfengeschwindigkeit und -größe) in einer Ölvormischstrecke. Projektbericht, DLR-Interner Bericht. Abschlußbericht zum TURBOFLAM II-Vorhaben, 72 S. Volltext nicht online.

  Brandt, M. und Hassa, Ch. und Kneer, R. und Lisiecki, D. und Tam, I. und Ledoux, M. und Cormack, G. und Hawkins, H.L. und Zasuja, A.K. (1992) Cross Correlation of Three Drop Sizing Techniques. In: 6th Int. Symp. on Appl. of Laser Techniques to Fluid Mechanics. Ladoan, Lisboa, Portugal. Volltext nicht online.

  Brandt, M. und Heeren, A. und Eckart, D. und Kremer, H. und Ridder, M. und Sick, V. (1997) A Laser-based Study of Kerosine Evaporation and Mixing in a Premix Duct for Gas Turbines at Elevated Pressures. Laser Anemometry Advances and Applications, 7th Int. Conference, September 8-11, 1997. Volltext nicht online.

  Brandt, M. und Rachner, M. und Schmitz, G. (1998) An experimental and numerical study of kerosine spray evaporation in a premix duct for gas turbine Combustors at high pressure. Combustion Science and Technology, Vol 138 (1-6), Seiten 313-348. Volltext nicht online.

  Brotzeller, K. (2003) Periodisches / transientes Verfahren zur Bestimmung von Wärmeübergangskoeffizienten. DLR-Interner Bericht. 225-2003 A 04, 75 S. Volltext nicht online.

  Brunner, B. und Deidewig, F. und Doepelheuer, A. und Lecht, M. und Lenic, J. und Schmitt, A. (1997) Die zeitliche Entwicklung der Verteilung der Luftverkehrsemissionen. Projektbericht, DLR-Interner Bericht. Zwischenbericht, BMBF 01LL 9502/0, 32 S. Volltext nicht online.

  Brunner, B. und Lenic, J. und Schmitt, A. und Deidewig, F. und Döpelheuer, A. und Lecht, M. (1998) Die zeitliche Entwicklung der Verteilung der Luftverkehrsemissionen. Projektbericht. 01 LL 9502/0. Volltext nicht online.

  Bruse, M. und Bechert, D. W. und Hage, E. und Hoppe, G. und van der Hoeven, J. G. (1996) Der Hai, und was daraus werden kann. Widerstandsvermindernde Oberflächen (riblets). Seminar für Strömungsmechanik, TU Berlin, 29.11.1996. Volltext nicht online.

  Bruse, M. und Bechert, D. W. und Hage, W. (1995) Shark Skin: Mechanism and Application. Invited Talk on Biomimetics and Bionics. St. Andrews Meeting of the Society for Experimental Biology, St. Andrews/Scotland, 3-7 April 1995. Volltext nicht online.

  Bruse, M. und Bechert, D. W. und Hage, W. (1995) Experiments with 3D and 2D Riblets and with the Slip Wall. Euromech Colloquium 332 - "Drag Reduction". 9th European Drag Reduction Meeting, Ravello/Italy, 19-21 April 1995. Volltext nicht online.

  Bruse, M. und Bechert, D. W. und Hage, W. (1996) Fluid mechanics of the shark skin and its technical application. XIXth International Congress of Theoretical and Applied Mechanics, Kyoto, Japan, 25-31 August 1996. Volltext nicht online.

  Bruse, M. und Bechert, D.W. und Hage, W. (1997) Velocity measurements over a riblet structured surface with hot-film probes. Euromech 3rd European Fluid Mechanics Conference 1997, September 1997, Göttingen. Volltext nicht online.

  Buchmann, N. A. und Willert, C. und Soria, J. (2011) Tomographic Particle Image Velocimetry using Pulsed, High Power LED Volume Illumination. 9th International Symposium on Particle Image Velocimetry – PIV’11, 21-23 Jul 2011, Kobe, Japan. file

  Buchmann, Nicolas A. und Willert, Christian und Soria, Julio (2010) Pulsed, high-power LED volume illumination for tomographic particle image velocimetry. 17th Australasian Fluid Mechanics Conference (AFMC), 05.-09. Dez. 2010, Auckland, New Zealand. Volltext nicht frei. filefile

  Buske, Clemens und Richter, Christoph und Thiele, Frank und Yu, Chao und Zhuang, Mei (2010) Validation of a Zonal Approach Computing the Sound Radiation from Lined Ducts. AIAA Journal, Vol. 48 (No. 12), Seiten 2899-2908. American Institute of Aeronautics and Astronautics (AIAA). DOI: 10.2514/1.J050478 Volltext nicht online.


  Carl, M. (1997) Inbetriebnahme des Hochdruckbrennkammerprüfstandes - Gläserne Brennkammer -. E3E-Workshop NOx-Reduktion durch Homogenisierung des Gemisches in Brennkammern, München, 23.-24.10. 1997. Volltext nicht online.

  Carl, M. (1997) Betrieb des Hochdruck-Komponentenprüfstands. E3E Workshop, BRR, Dahlewitz, 4.-5.12.1997. Volltext nicht online.

  Carl, M. (2003) Ergebnisse der Teilvorhaben des DLR mit Rolls-Royce Deutschland und MTU im Rahmen des Forschungsvorhabens Engine 3E. Projektbericht, DLR-Interner Bericht. 325-09-03, 191 S. Volltext nicht online.

  Carl, M. (1996) Umbau- und Inbetriebnahme des Hochdruckbrennkammer-Pruefstandes - Glaeserne Brennkammer. 1. Workshop d. MTU-Engine 3E-Brennkammertechnologieprog.NOx-Reduktion durch Homogenisierung d. Gemisches in Brennkammern, MTU, 22.10.1996. Volltext nicht online.

  Carl, M. und Behrendt, T. und Fleing, C. und Frodermann, M. und Heinze, J. und Hassa, C. und Meier, U. und Wolff-Gaßmann, D. und Hohmann, S. und Zarzalis, N. (2000) Experimental and Numerical Investigations of a Planar Combustor Sector at Realistic Operating Conditions. In: ASME TURBO EXPO 2000. ASME TURBO EXPO 2000: Land, Sea and Air, Munich, Germany, 8-11 May, 2000. Volltext nicht online.

  Carl, M. und Behrendt, T. und Fleing, C. und Frodermann, M. und Heinze, J. und Hassa, C. und Meier, U. und Wolff-Gaßmann, D. und Hohmann, S. und Zarzalis, N. (2001) Experimental and Numerical Investigation of a Planar Combustor Sector at Realistic Operating Conditions. Transactions of the ASME - A - Engineering for Gas Turbines and Power, 123 (4), Seiten 810-816. Volltext nicht online.

  Carl, M. und Behrendt, T. und Fleing, C. und Frodermann, M. und Heinze, J. und Röhle, I. und Hassa, C. und Lückerath, R. und Meier, U. und Schneider-Kühnle, Y. und Wolff-Gaßmann, D. und Laible, C. und Ziegler, M. (1999) Experimentelle und numerische Untersuchung der Verbrennung im ebenen Sektor einer gestuften Brennkammer bei realistischen Betriebsbedingungen. In: Luft- und Raumfahrt vor dem neuen Jahrtausend, DGLR-JT99-188. DGLR,Bonn,Deutschland. DGLR Jahrestagung, Berlin, 27.-30.09.1999. Volltext nicht online.

  Carl, M. und Frodermann, M. und Behrendt, T. und Heinze, J. und Röhle, I. und Hassa, C. und Brehm, N. und Schilling, T. und Doerr, T. (1998) Experimental Investigations of an Axially Staged Combustor Sector with Optical Diagnostics at Realistic Operating Conditions. In: RTO Meeting Proceedings 14, Gas Turbine Engine Combustion, Emissions and Alternative Fuels, RTO-MP-14, 18-1-18-11. Canada Communication Group Inc.. RTO Symposium, Lisboa, Portugal, 12.-16.10.,1998. ISBN 92-837-0009-0 Volltext nicht online.

  Carrarini, A. (2000) Strömungsmechanische Effekte in der Mehrkörpersimulation bodengebundener Fahrzeuge. DLR-Interner Bericht. 532-00-04, 43 S. Volltext nicht online.

  Ch. Resag, R. Schodl (1992) Theoretische und experimentelle Untersuchungen zur Auslegung ei- ner Lichtschnittsonde fuer die Sichtbarmachung von Stofronten in transsonischen Stroemungen. sonstiger Bericht. Volltext nicht online.

  Cheishvili, Konstantine (2016) Development and Validation of an End-to-End Simulator for Frequency Scanning Filtered Rayleigh Scattering Techniques. Masterarbeit, TU Delft. Volltext nicht frei. file

  Cherednichenko, Svetlana und Frey, Christian und Ashcroft, Graham (2012) On the Application of the Discontinuous Galerkin Method to Turbomachinery Flows. In: 6th European Congress on Computational Methods in Applied Sciences and Engineering, Seiten 2359-2375. ECCOMAS 2012, 10.-14. Sep. 2012, Vienna, Austria. ISBN 978-3-9502481-9-7 file


  Dahlmann, Katrin und Koch, Alexander und Linke, Florian und Grewe, Volker und Otten, Tom und Seider, Doreen und Gollnick, Volker und Schumann, Ulrich (2016) Climate-Compatible Air Transport System - Climate Impact Mitigation Potential for Actual and Future Aircraft. Aerospace, Seiten 1-25. Multidisciplinary Digital Publishing Institute (MDPI). DOI: 10.3390/aerospace3040038 ISSN 2226-4310 file

  Dannemann, Martin und Kucher, Michael und Kunze, Eckhart und Modler, Nils und Knobloch, Karsten und Enghardt, Lars und Sarradj, Ennes und Höschler, Klaus (2018) Experimental Study of Advanced Helmholtz Resonator Liners with Increased Acoustic Performance by Utilising Material Damping Effects. Applied Sciences, 8 (10), Seite 1923. Multidisciplinary Digital Publishing Institute (MDPI). DOI: 10.3390/app8101923 ISSN 2076-3417 file

  Deick, A. (1993) Messung und Beurteilung des Geschwindigkeits- und Temperaturfeldes sowie der Abgaszusammensetzung einer Brennkammerkonfiguration mit Luftstromzerstaeuber. Diplomarbeit. Volltext nicht online.

  Deidewig, F. (1991) Ein Beitrag zur Berechnung von Einstrom-Turboluftstrahltriebwerken (TL) und Zweistrom-Turboluftstrahltriebwerken (ZTL). DLR-Interner Bericht. 325-12-91, 83 S. Volltext nicht online.

  Deidewig, F. (1994) Emissionen aus Verkehrsflugzeugen und Methoden zur Emissionsverminderung. 1. DFG-Schwerpunkt "Grundlagen der Auswirkungen der Luft- und Raumfahrt auf die Atmosphäre, DFG-Kolloquium, München, 19.04.93. Volltext nicht online.

  Deidewig, F. (1994) Leistungsanalyse ziviler Zweistromtriebwerke unter Beruecksichtigung der emittierten Schadstoffe. TU Berlin, 26.11.93. Volltext nicht online.

  Deidewig, F. (1993) Thermodynamische Teillastrechnungen gemischter und ungemischter ZTL-Triebwerke bei Beruecksichtigung variabler Geometrien. DLR-Interner Bericht. 325-04-93, 25 S. Volltext nicht online.

  Deidewig, F. (1994) Aircraft Emission - Thermodynamical Engine Performance Codes. ECAC /ANCAT Emissions Inventory Database Group 10.Febr. 1994 Department of Trade and Industry, London, UK. Volltext nicht online.

  Deidewig, F. (1995) Studies on NOx-Emissions of SST Engine Concepts. Vortrag 86.AGARD Tagung in Seattle, 25.09.-29.09.95, USA. Volltext nicht online.

  Deidewig, F. (1996) Potentiale alternativer Antriebskonzepte gegenueber dem Olympus-Triebwerk der Concorde. Ueberschallflugverkehr Lufthansa Frankfurt, Jan. 1996. Volltext nicht online.

  Deidewig, F. (1998) Ermittlung der Schadstoffemissionen im Unter- und Überschallflug. Dissertation. DLR-Forschungsbericht. 98-10, 174 S. Volltext nicht online.

  Deidewig, F. und Doepelheuer, A. (1995) Studies on NOx-Emissions of SSt Engine Concepts. AGARD, Neuilly-sur-Seine, Frankreich. Volltext nicht online.

  Deidewig, F. und Doepelheuer, A. und Lecht, M. (1995) Überprüfung und Weiterentwicklung von Schadstoff-Korrelationen auf Höhenflugzustände. Projektbericht, DLR-Interner Bericht. Volltext nicht online.

  Deidewig, F. und Doepelheuer, A. und Lecht, M. (1995) Abschlußbericht zum Forschungsvorhaben "Überprüfung und Weiterentwicklung von Schadstoffkorrelationen auf Höhenflugzustände. Projektbericht, DLR-Interner Bericht. Volltext nicht online.

  Deidewig, F. und Doepelheuer, A. und Lecht, M. (1996) Methods to Assess Aircraft Engine Emissions in Flight. 20th Congress of the Int. Council of the Aeronautical Sciences 1996 (ICAS), 8-13 Sept. 1996, Sorrent, Italien. Volltext nicht online.

  Deidewig, F. und Döpelheuer, A. und Lecht, M. (1994) Leistungs- und Emissionsverhalten zukünftiger Überschalltriebwerke. In: DGLR-Jahrbuch 1994. DGLR, Deutsche Gesellsch. f. Luft-u. Raumfahrt, Bonn. Volltext nicht online.

  Deidewig, F. und Lecht, M. (1994) Estimates for NOx-Emissions in Flight with a Minimum of Aircraft and Engine Data. ICAO/CAEP, WG 3 Certification/Technology Subgroup, 05.-07.05.93, Ottawa, Canada. Volltext nicht online.

  Deidewig, F. und Lecht, M. (1994) Ueberpruefung und Weiterentwicklung von Schadstoffkorrelationen auf Hoehenflugzustaende. Projektbericht, DLR-Interner Bericht. Volltext nicht online.

  Deidewig, F. und Lecht, M. (1996) Ermittlung der von Flugzeugen waehrend typischer Flugmissionen emittierten Schadstoffmengen auf die Atmosphäre. Poster zum Abschlusskolloquium, DFG Schwerpunkt Grundlagen der Auswirkung d. Luft-u.Raumfahrt auf die Atmosphaere, 11./12.12.96, DLR. Volltext nicht online.

  Deidewig, F. (1992) Schadstoffemissionen ziviler Flugtriebwerke am Beispiel des CFM56-3 und CSF-80C2. DLR-Interner Bericht. 325-04-92, 89 S. Volltext nicht online.

  Diers, O. und Behrendt, T. und Cordes, S. und Fischer, M. und Koopman, J. und Hassa, C. (1999) Large Engines Combustor Demonstrator - Technology Demonstration - Investigation of First Advanced Cooling Mixing Concept. Projektbericht, DLR-Interner Bericht. 325-07-99, 52 S. Volltext nicht online.

  Diers, O. und Giuliani, F. und Biscos, Y. und Gajan, P. und Ledoux, M. (2001) Phasenaufgelöste LDA-Messungen in der Gasströmung einer Luftstromzerstäuberdüse. In: Lasermethoden in der Strömungsmesstechnik, 36.1-36.7. Shaker Verlag, Aachen, Deutschlang. 9. Fachtagung Lasermethoden in der Strömungsmesstechnik, GALA,Winterthur, Schweiz, September 2001. ISBN 3-8265-9214-x Volltext nicht online.

  Diers, O. und Hassa, C. (2005) Experimentelle Analyse der Brennkammerschwingungen, Vorhaben 4.4.1. Projektbericht, DLR-Interner Bericht. 325-07-05, 50 S. Volltext nicht online.

  Diers, O. und Koopman, J. und Fischer, M. und Hassa, C. (2001) Investigation of two advanced cooling mixing concepts for a rich quench lean combustor. In: ASME Turbo Expo 2001, Seiten 1-8. ASME Turbo Expo 2001, New Orleans, USA, June 4-8, 2001. Volltext nicht online.

  Diers, O. und Koopman, J. und Hassa, C. (2000) Large Engines Combustor Demonstrator - Technology Demonstration - Investigation of Second Advanced Cooling Mixing Concept. Projektbericht, DLR-Interner Bericht. 325-03-2000, 64 S. Volltext nicht online.

  Diers, Olaf und Heinze, Johannes und Hassa, Christoph und Giezendanner-Thoben, Robert (2005) Thermoakustisches Verhalten eines Gasturbinenbrenners realer Größe in einer akustisch abstimmbaren Brennkammer. In: VDI-Berichte, 1888, Seiten 195-206. VDI Verlag Düsseldorf. 22. deutscher Flammentag, 2005-09-21 - 2005-09-22, Braunschweig. Volltext nicht online.

  Dietz, O. und Fidora, F. (1994) Auslegung eines Keildiffusors fuer Ueberschallstroemungen. sonstiger Bericht. Volltext nicht online.

  Dingel, O. und Seidel, T. und Schodl, R. und Willert, C. (2002) Messung der Zylinderinnenströmung mit Doppler Global Velocimetry. Proceedings der HdT-Tagung: Optisches Indizieren - Verbrennungsentwicklung für Otto- und Dieselmotoren, Essen, 14. Nov., 2002.. Volltext nicht online.

  Doepelheuer, A. (1998) Influence of engine performance on emission characteristics. RTO/AVT Symposium on "Gas Turbine Combustion, Emissions and Alternative Fuels", Lisboa, Portugal, 12.-16. Oct. 1998. Volltext nicht online.

  Doepelheuer, A. (1994) Abschaetzung des Brennstoffverbrauchs und der NOx-Emission von Ueberschallverkehrsflugzeugen. DLR-Interner Bericht. 325-13-94, 160 S. Volltext nicht online.

  Doepelheuer, A. (1997) Berechnung der Produkte unvollständiger Verbrennung aus Luftfahrttriebwerken. DLR-Interner Bericht. 325-09-97, 38 S. Volltext nicht online.

  Doepelheuer, A. (1997) Emissionsmodellierung. Projektbericht, DLR-Interner Bericht. Abschlußbericht F & E-Vorhaben Nr. 105 06 085, Auftrag Nr. 934/375050, 74 S. Volltext nicht online.

  Doepelheuer, A. und Kruse, H. (1997) Measurements of Trace Species in the Exhaust of Aero Engines (AEROTRACE). DLR-Interner Bericht. Finale Report 1997, Task 6, Abschlussbericht, CEC Contract No. AEREA-CT-94-0003. Volltext nicht online.

  Dresbach, Christian und Buske, Clemens und Schmidt, Thomas und Zur, Sascha (2017) Titanium Aluminide Turbine Toolbox : Teilprojekt DLR : Schlussbericht zum Verbundprojekt TATT. Projektbericht. IB-334-03/17, 69 S. Volltext nicht frei. file

  Dreßen, S. und Zachcial, A. (2004) Analyse des Einflusses der Kavitätenströmung auf die Hauptströmung in mehrstufigen Verdichtern mittels numerischer Simulation. Diplomarbeit. DLR-Interner Bericht. 325-13-04, 72 S. Volltext nicht online.

  Duikeren, B. van (2004) Design of heat transfer instrumentation to be applied at the wind tunnel for rotating cascades at DLR, Göttingen. Diplomarbeit. sonstiger Bericht. 225-2004 A 01, 98 S. Volltext nicht online.

  Dzikus, Niclas und Wollenheit, Richard und Schaefer, Martin und Gollnick, Volker (2014) Assessing the Potential Benefit of Future Technologies to Reduce the Environmental Impact of Airport Operations. AIAA/3AF Aircraft Noise and Emissions Reduction Symposium, 16.-20.Juli 2014, Atlanta, USA. Volltext nicht frei. file

  Döpelheuer, A. (2001) Characterization of Aircraft-Generated Soot by Computational Means. ASE-E31 Committee, Derby, UK, June 26-28. Volltext nicht online.

  Döpelheuer, A. (2000) Aircraft Emission Parameter Modelling - Dossier "Aviation and the Environment". Air and Space Europe, Editions Elsevier (May-June 2000). Volltext nicht online.

  Döpelheuer, A. (2001) Quantities, Characteristics and Reduction Potentials of Aircraft Engine Emissions. Aerospace Congress, Washington, USA, Sept. 10-14, 2001. Volltext nicht online.

  Döpelheuer, A. und Aigner, M. und Wahl, C. (2000) Emissionen von Flugtriebwerken unter realen Betriebsbedingungen. Kolloquium der Arbeitsgruppe Luftreinhaltung der Universität Stuttgart, 5.10.2000. Volltext nicht online.

  Döpelheuer, A. und Lecht, M. (1999) Influence of engine performance on emission characteristics. In: Gas Turbine Engine Combustion, Emissions and Alternative Fuels Canada Communication Group. Inc.. 20-1-20-12. ISBN 92-837-0009-0. Volltext nicht online.

  Döpelheuer, A. und Tilstom, J.R. (2001) New Cycle and Emission Studies - the CYPRESS Project. Air and Space Europe, Vol. 3 (No. 3/4). Volltext nicht online.

  Döpelheuer, A. und Wahl, C. (2000) Determination of Quantities and Properties of Aircraft Engine Generated Soot. In: Aviation, Aerosols, Contrails and Cirrus Clouds Air Pollution Research Report 74, EUR 19428. Volltext nicht online.

  Dörr, Th. und Rachwitz, L. und Schilling, Th. und Hassa, C. und Behrendt, Th. und Stursberg, K. und Heinze, J. und Jarius, M. (2002) Brennstoffaufbereitung in mager vorgemischten Flammen. 8. Statusseminar AG-TURBO: Verbundprojekt für ein CO2-armes Kraftwerk, Köln, 5./6. Dez, 2002., 2002-12-05 - 2002-12-06, Köln. Volltext nicht online.

  de Martel, E. (2002) Etalonnage d'une quadruple prise de pression totale et de deux sondes pneumatiques à trois trous en domaine subsonique. DLR-Interner Bericht. 225-2002 A 01, 43 S. Volltext nicht online.


  Eberz, T. (1993) Kritische Ueberpruefung und Entwicklung des numerischen Stroemungsloesers NEWT im Hinblick auf Turbomaschinenanwendungen. sonstiger Bericht. Dipl.-Arbeit, GS Siegen, Dezember 1993, 146 S. Volltext nicht online.

  Eckardt, D. und Krain, H. (1995) Synergie von Messung und Rechnung an Radialverdichtern. In: Beiträge zu Fluidenergiemaschinen Band 2. Verlag W. H. Faragallah, Sulzbach im Taunus. Seiten 40-52. ISBN 3-929682-68-7. Volltext nicht online.

  Egmann, S. und Reinmoller, U. und Niehuis, R. und Förster, W. und Beversdorff, M. und Gier, J. (2002) Improving 3D flow characteristics in a multistage LP turbine by means of endwall contouring and airfoil design modification - Part 1: Desing and experimental investigation. Proc. of IGTI'02, ASME TURBO EXPO 2002, Amsterdam (NL), 3-6 June, 2002.. Volltext nicht online.

  Eickhoff, H. (2002) On steady and unsteady turbulent flame propagation. Projektbericht, DLR-Interner Bericht. 325-02-02, 17 S. Volltext nicht online.

  Eickhoff, H. (2003) Turbulente Flammengeschwindigkeit. Projektbericht, DLR-Interner Bericht. 12-03, 16 S. Volltext nicht online.

  Eickhoff, H. (2002) Analysis of turbulent burning velocity. Combustion and Flame, 128, Seiten 347-350. Volltext nicht online.

  Eickhoff, H. (1994) Fundamental Research on Lean Premixed Prevaporized Combustion. Minutes at the Midterm Review Meeting at the BRITE/EURAM Low Emission Combustion Program, 22.09.94, Cranfield University, England. Volltext nicht online.

  Eickhoff, H. und Lenze, B. und Streb, H. (1993) Influence of Re-number on the spreading of H2-diffusion flames. In: Proc. Joint Meeting of the British and German Sections of the Combustion Institute, Cambridge, 29 March-2 April, 1993 1. Joint Meeting of the British and German Sections of the Combustion Institute, Queen's College, Cambridge, UK, 29.3.-2.4.1993. Volltext nicht online.

  Eickhoff, H. und Lenze, B. und Streb, H. (1993) Influence of Reynolds-number on the spreading of H2-diffusion flames. DLR-Interner Bericht. 325-05-93, 10 S. Volltext nicht online.

  Eickhoff, H. und Miebach, R. (Deutz Motor Köln) (1996) Full Flow particulate filtering with thermal regeneration in the exhaust of Diesel engines. International Symposium Towards Clean Diesel Engines, Nijmegen, 1996. Volltext nicht online.

  Eickhoff, H. und Schmitz, G. und Schuetz, H. und Rachner, M. (1997) Untersuchungen zur Spray-Verdampfung und Verbrennung im Rahmen des CRAY-TECFLAM Projektes. Externes 13. Tecflam-Seminar, Koeln, Nov. 1997. Volltext nicht online.

  Eickhoff, H. und Winterfeld, G. und Depooter, K. (1990) Fuel Injectors. In: Chapter 3 in "Design of Modern Turbine Combustors". Academic Press, London.. Seiten 229-323. Volltext nicht online.

  Eickhoff, H.E. und Braun-Unkhoff, M. und Frank, P. (2002) Lean Blowout for Swirl Stabilized Combustion. Projektbericht, DLR-Interner Bericht. 235-01-2002, 8 S. Volltext nicht online.

  Eisenberg, B. (1) und Steinert, W. (1990) Entwurf und experimentelle Untersuchung eines hochbelasteten Unterschallgitters aus einem Industrieverdichter. Seminarvortrag im Institut fuer Antriebstechnik, 22. Mai 1990. Volltext nicht online.

  Eisenlohr, G. und Dalbert, P. und Krain, H. und Pröll, H. und Richter, F. A. und Rohne, K. H. (1998) Analysis of the Transonic Flow at the Inlet of a High Pressure Ratio Centrifugal Impeller. In: ASME-Paper, 11Seiten-. IGTI, 5775-B Glenridge Dr. #370, Atlanta, GA 30328, USA. ASME-Conference, Stockholm, June 1998. Volltext nicht online.

  Eisenlohr, G. und Krain, H. und Richter, F. A. und Tiede, V. (2002) Investigations of the Flow through a High Pressure Ratio Centrifugal Impeller. ASME Paper, GT-2002-30394 (CD: Proceedings Turbo Expo 2002), Seiten 1-9. Volltext nicht online.

  Elfert, M. (1994) The Effect of Rotation and Buoyancy on Radially Inward and Outward Directed Flow in a Rotating Circular Coolant Channel. Proceedings of 49th ATI Congress of Thermotechnical Association, Italy, Sept. 26-30, 1994. Volltext nicht online.

  Elfert, M. (1994) The Effect of Rotation and Buoyancy on Flow Development in a Rotating Circular Coolant Channel with Radial Inward Flow. Journal of Experimental Thermal and Fluid Science, Verlag: Elsevier, New York, USA, 10Seiten-. Volltext nicht online.

  Elfert, M. (2001) The Influence of Cooling Air Ejection on Flow Development and Heat Transfer in a Rotating Leading Edge Coolant Duct of a Film-Cooled Turbine Blade. In: Part B - Heat Transfer and Cooling in Propulsion and Power Systems, Seiten 1-12. Nato, RTO (Research and Technology Organization, Paris, Frankreich. AVT Spring Meeting and Panel Business Week, Part B - Heat Transfer and Cooling in Propulsion and Power Systems Symposium on Advanced Flow Management, May 7-11, 2001, Loen, Norway. Volltext nicht online.

  Elfert, M. (1991) The effect of rotation on local coolant side flow and heat transfer in turbine blades. 10th International Symposium on Air Breathing Engines (ISABE), Nottingham (UK), 01.-06.09.91. Volltext nicht online.

  Elfert, M. (1993) Stroemung und Waermeuebergang in rotierenden Kuehlkanaelen. Kolloquium Energietechnik, RUB Bochum. Volltext nicht online.

  Elfert, M. (1993) Waermeuebergang in rotierenden Kuehlkanaelen von Gasturbinenschaufeln. DLR-Interner Bericht. 325-01-93, 68 S. Volltext nicht online.

  Elfert, M. (1994) Stroemungs- u. Waermeuebergang in rotierenden Kuehlkanaelen mit Kuehlluftausblasung. 1.Arbeitskreissitzung, AG Turbo, Turbotherm II, 28.10.1993, MTU, Muenchen. Volltext nicht online.

  Elfert, M. (1996) Stroemung und Waermeuebergang in rotierenden Kuehlkanaelen mit Filmkuehlausblasung. Arbeitskreissitzung AG-Turbo, Turbotherm II, 21.6.96, Muenchen. Volltext nicht online.

  Elfert, M. (1996) Stroemung und Waermeuebergang in rotierenden Kuehlkanaelen mit Filmkuehlausblasung. Arbeitskreissitzung AG-Turbo, TurbothermII, 13.12.96, Karlsruhe. Volltext nicht online.

  Elfert, M. (1997) Stroemung und Waermeuebergang in rotierenden Kuehlluftkanaelen unter dem Einfluss von Kuehlluftausblasung. Projektbericht, DLR-Interner Bericht. Abschlußbericht AG Turbo, Turbotherm II, Vorhaben Volltext nicht online.

  Elfert, M. und Hoevel, H. und Towfighi, K. (1996) The Influence of Rotation and Buoyancy on Radially Inward and OutwardDirected Flow in a Rotating Circular Coolant Channel. AIAA, Reston, VA (USA). Proc. of the 20th Congress of the Int. Council of the Aeronautical Sciences (ICAS), 8-13 Sept. 1996, Sorrento, Italy ICAS-Paper 96-6.10$. Volltext nicht online.

  Elfert, M. und Jarius, M. P. (2002) Steady Fluid Flow Investigation Using L2F and PIV in a Multi-Pass Coolant System. In: Tansport Phenomena and Dynamics of Rotating Machinery, Seiten 1-10. Proceedings of the 9th International Symposium on Transport Phenomena and Dynamics of Rotating Machinery, ISROMAC-9, Honolulu, Hawaii, USA, February 10-14 2002,. Volltext nicht online.

  Elfert, M. und Jarius, M.P. (2002) Steady Fluid Flow Investigation Using L2F and PIV in a Multi-Pass Coolant System. In: Transport Phenomena and Dynamics of Rotating Machinery, ISROMAC 9, Seiten 1-10. Pacific Center of Thermal-Fluids Engineering, USA. Proceedings of the 9th International Symposium on Transport Phenomena and Dynamics of Rotating Machinery, ISROMAC-9, Honolulu, Hawaii, USA, February 10-14, 2002. Volltext nicht online.

  Elfert, M. und Jarius, M.P. (2004) Detaild flow investigation using PIV in a typical turbine cooling geometry with ribbed walls,GT-2004-53566. In: Proceeding. ASME TURBO EXPO 2004,June 14-17,2004 Vienna,Austria. Volltext nicht online.

  Elfert, M. und Towfighi, K. (1996) Stroemung und Waermeuebergang in rotierenden Kuehlluftkanaelen unter dem Einfluss von Kuehlluftausblasung. Tagungsband zum 5. Statusseminar der Arbeitsgemeinschaft Hochtemperatur-Gasturbine, 5.-6. Maerz 1996, Sekretariat der AG-Turbo. Volltext nicht online.

  Elfert, M. und Towfighi, K. (1997) Ermittlung des inneren Wärmeübergangs in rotierenden Kühlluftkanälen mit Filmkühlausblasung. Projektbericht, DLR-Interner Bericht. Abschlußbericht AG Turbo, Turbotherm II, Vorhaben Volltext nicht online.

  Elfert, M. (1992) Waermeuebergang in rotierenden Kuehlkanaelen von Gasturbinenschaufeln. In: Tagungsband des 3. Statusseminars der Arbeitsgemeinschaft Hochtemperatur-Gasturbine, 3.-4.12.1992, Sekr. AG Turbo, DLR-KP, Seiten 43-57. 3. Statusseminar AG TURBO, 3.-4.12.1992, Köln-Porz. Volltext nicht online.

  Elfert, Martin (1993) The Effect of Rotation and Buoyancy on Flow Development in a Rotating Circular Coolant Channel. Proceedings ot the 2nd International Symposium on Engineering Turbule nce Modelling and Measurements, May 31 - June 2, 1993, Florenc, Italy. Volltext nicht online.

  Elfert, Martin und Voges, Melanie und Klinner, Joachim (2008) Detailed Flow Investigation Using PIV in a Rotating Square-Sectioned Two-Pass Cooling System with Ribbed Walls. In: ASME-Paper, GT2008-51183. ASME Turbo Expo 2008, 2008-06-09 - 2008-06-13, Berlin, Germany. Volltext nicht frei. file

  Elfert, Martin und Schroll, Michael und Förster, Wolfgang (2010) PIV-Measurement of Secondary Flow in a Rotating Two-Pass Cooling System With An Improved Sequencer Technique. In: Proceedings of the ASME TURBO EXPO 2010, June 14-18, 2010, Glasgow, UK (GT-201). ASME TURBO EXPO 2010, 14.-18. Juni 2010, Glasgow, UK. Volltext nicht frei. file

  Elfert, M, (1993) Wärmeübergang in rotierenden Kühlkanälen von Gasturbinenschaufeln. Projektbericht, DLR-Interner Bericht. Abschlußbericht AG Turbo Vorhaben Volltext nicht online.

  Elfert, M., Hoevel, H., Jarius, M., (2004) Optimierung von rotierenden Multipass-Kühlsystemen, Teil A: Strömungs- und Druckverlustmessung im rotierenden Modell. Projektbericht, DLR-Interner Bericht. Abschlussbericht AG Turbo II, Verbundvorhaben GuD-Kraftwerk, 500MW auf einer Welle, Vorhaben 2.4.4A, 107 S. Volltext nicht online.

  Engel, K. (1990) Aufbau eines interaktiven Gitterauslegungssystems und dessen Implementierung auf einem Parallelrechner. DLR-Interner Bericht. 325-02-90, 95 S. Volltext nicht online.

  Engel, K. (1994) Numerical Investigation of the Rotor-Stator Interaction in a Transonic Compressor Stage. Vortrag am 05.07.94, NASA-Lewis, Cleveland (OAI). Volltext nicht online.

  Engel, K. (1995) Numerische Untersuchung des "Clocking" Effekts in einer Stator-Rotor-Stator Konfiguration. MTU Workshop, 22.09.1995, MTU Muenchen. Volltext nicht online.

  Engel, K. (1997) Numerische Simulation der instationären Strömung in Turbomaschinenkomponenten. Dissertation. DLR-Forschungsbericht. 97-19, 135 S. Volltext nicht online.

  Engel, K. und Eulitz, F. (1995) Entwicklung eines 3-D Navier Stokes Loesers zur Simulation der instationaeren Stroemung in Turbomaschinen. DFG-Symposium "Stroemungssimulation auf Hochleistungsrechnern", 04.05.1995, Bonn, Bad Godesberg. Volltext nicht online.

  Engel, K. und Eulitz, F. (1996) Numerical Investigation of the Unsteady Flow Through Turbomachinery Components. CFD-Symposium, 14th Japanes CFD Conference, NAL, Chofu, Tokyo, 1996. Volltext nicht online.

  Engel, K. und Eulitz, F. (1996) Numerische Simulation der zeitabhaengigen Stroemung in Turbomaschinenkomponenten. Zentrumskolloquium in Goettingen, 01.02.96. Volltext nicht online.

  Engel, K. und Eulitz, F. (1996) Numerical Investigation of the Unsteady Flow through Turbomachinery Components. Vortrag bei IHI, Tokyo, 15.06.1996. Volltext nicht online.

  Engel, K. und Eulitz, F. (1996) Numerical Investigation of the Unsteady Flow through Turbomachinery Components. Proceedings zum 14th Japanes CFD Conference NAL, Chofu, Japan Juni 1996. Volltext nicht online.

  Engel, K. und Eulitz, F. (1997) Numerische Untersuchung der zeitabhaengigen Stroemung in Turbomaschinen-Komponenten. Vortrag ABB Baden, 27.02.1997, Baden, Schweiz. Volltext nicht online.

  Engel, K. und Eulitz, F. (1996) Der Entwicklungsstand des 3D-Navier-Stokes Verfahrens TRACE. Workshop bei MTU Muenchen, 8.10.1996. Volltext nicht online.

  Engel, K. und Eulitz, F. und Faden, M. und Pokorny, S. (1993) Numerical Investigation of the Unsteady Flow in Transonic Fan. Vortrag DFG-Symposium, CFD on Parallel Systems, 9.-10.12.1993, Universitaet Stuttgart. Volltext nicht online.

  Engel, K. und Eulitz, F. und Faden, M. und Pokorny, S. (1994) Numerical Investigation of the Rotor-Stator Interaction in a Transonic Compressor Stage. 30th AIAA/ASME/SAE/ASEE Joint Propulsion Conference, June 27-29, 1994, Indianapolis. Volltext nicht online.

  Engel, K. und Eulitz, F. und Faden, M. und Pokorny, S. (1994) Numerical Simulation of the Unsteady Turbomachinery Flow on a MIMD Machine. Vortrag auf der HPCN 1994 Conference, Muenchen, 19.04.94. Volltext nicht online.

  Engel, K. und Eulitz, F. und Faden, M. und Pokorny, S. (1994) Validation of TVP-Schemes for Unsteady Turbomachinery Flow. In: Lecture Notes in Physics, Springer Verlag. Volltext nicht online.

  Engel, K. und Eulitz, F. und Faden, M. und Pokorny, S. (1994) Numerical Investigation of the Shock Induced Interaction in a Transonic Compressor Stage. International Symposium on Unsteady Flows in Aeropropulsion: Recent Advances in Experimental and Computational Methods. Volltext nicht online.

  Engel, K. und Eulitz, F. und Faden, M. und Pokorny, S. (1994) Entwicklung eines 3D Stroemungsloesers auf einem Parallelprozessorsystem zur Berechnung der instationaeren Stroemung in einer Turbomaschine (We 1450/1-3). Vortrag im Rahmen des DFG-Schwerpunktprogramms "Stroemungssimulation auf Hochleistungsrechnern", 23.-24. Juni 1994, Bad Godesberg. Volltext nicht online.

  Engel, K. und Eulitz, F. und Gebing, H. (1996) Numerische Simulation der instationaeren Stroemung in Turbomaschinenkomponenten. Teil 1: Allgemein. Zentrumskolloquium, DLR-Göttingen, 1. Februar 1996. Volltext nicht online.

  Engel, K. und Eulitz, F. und Gebing, H. und Faden, M. und Pokorny, S. (1996) Anwendung neuer Konzepte zur Lösung komplexer Strömungsprozesse. DLR-Nachrichten (83), Seiten 6-10. Volltext nicht online.

  Engel, K. und Eulitz, F. und Pokorny, S. (1994) Numerical Investigation of the Rotor-Stator Interaction in a Transonic Compressor Stage. 30th AIAA/ASME/SAE/ASEE Joint Propulsion Conference, June 27-29, 1994, Indianapolis, USA. Volltext nicht online.

  Engel, K. und Eulitz, F. und Pokorny, S. (1) und Faden, M. (1) (1996) 3-D-Navier-Stokes Solver for the Simulation of the Unsteady Turbomachinery Flow on a Massively Parallel Hardware Architecture. In: Notes on Numerical Fluid Dynamics, Vol. 52: Flow Simulation with High-Performance Computers II (1996); ed. E. H. Hirschel, Seiten 117-133. Volltext nicht online.

  Engel, K. und Faden, M. und Pokorny, S. (1991) Arbeitsbericht zum Forschungsvorhaben Entwicklung eines 3-D-Strömungslösers. DFG-Schwerpunktskolloquium, 1991, Aachen. Volltext nicht online.

  Engel, K. und Faden, M. und Pokorny, S. (1991) Arbeitsbericht zum Forschungsvorhaben 3D-instationärer Strömungslöser. DFG-Zwischenbericht 1991. Volltext nicht online.

  Engel, K. und Faden, M. und Pokorny, S. (1991) Anfangs- und Randwertformulierung bei der Lösung der zeitabhängigen Eulergleichungen. Vortrag bei der Universität Bonn, 26.11.91. Volltext nicht online.

  Engel, K. und Faden, M. und Pokorny, S. (1993) Implementation of Non-Reflecting Boundary Conditions in an Unsteady Flow Simulation System. In: Numerical Methods for Fluid Dynamics 4 4. Seiten 483-501. Volltext nicht online.

  Engel, K. und Faden, M. und Pokorny, S. (1993) Entwicklung eines dreidimensionalen Stroemungsloesers auf einem Parallelprozessorsystem zur Berechnung der instationaeren Stroemung in einer Turbomaschine. Vortrag im Rahmen des DFG-Schwerpunktprogramms "Stroemungssimulation auf Hochleistungsrechnern", 06.05.1993, Bad Godesberg. Volltext nicht online.

  Engel, K. und Faden, M. und Pokorny, S. (1993) Forschungsvorhaben 3D-instationäre Strömung. Projektbericht. We 1450/1-1, 10 S. Volltext nicht online.

  Engel, K. und Faden, M. und Pokorny, S. (1992) Implementation of non-reflecting boundary conditionsin an unsteady flow siulations system. ICFD conference on numerical methods for fluid dynamics, 7.-10.04.92. Volltext nicht online.

  Engel, K. und Faden, M. und Pokorny, S. (1992) Randbedingungsforulierung fuer instationaere Innenstroemungsprobleme. Kolloquium Stroemungsmaschinen Universitaet Essen, 29.06.1992, Essen. Volltext nicht online.

  Engel, K. und Faden, M. und Pokorny, S. (1992) Numerical investigation of the unsteady flow through counterrotating fan. 18th ICAS Congress, 20.-25.09.1992, Peking, China. Volltext nicht online.

  Engel, K. und Faden, M. und Pokorny, S. (1992) Entwicklung eines 3-D Stroemungsloesers. DFG-Schwerpunktskolloquium 1992, Bad Godesberg. Volltext nicht online.

  Engel, K. und Faden, M. und Pokorny, S. (1992) Implementation of non-reflecting boundary conditions in an unsteady flow simulation system. ICFD Conference on Numerical Methods for Fluid Dynamics , 7.-10.04.92. Volltext nicht online.

  Enghardt, L. und Neise, W. und Schewe, G. und Schimming, P. und Schmitt, S. und Schnell, R. und Wallscheid, L. und Zhang, Y. (2000) Strömungsuntersuchungen in einem fünfstufigen Axialverdichter (Abschlussbericht). Projektbericht, DLR-Interner Bericht. --Teilprojekt 1.141, Turbotech II, FKZ: 0327040B, 88 S. Volltext nicht online.

  Enghardt, L. und Tapken, U. und Neise, W. und Schimming, P. und Maier, R. und Zillmann, J. (2003) Active control fan noise from high-byass ratio aeroengines: experimental results. The Aeronautical Journal, 106 (1063), Seiten 501-506. Volltext nicht online.

  Euler, H.-G. (1) und Steinert, W. (1990) Experimentelle Untersuchung des Gitters TSG 89-5 im transsonischen Gitterwindkanal und Vergleich mit den Ergebnissen des Verdichtergitters LO30-4. DLR-Interner Bericht. 325-06-90, 66 S. Volltext nicht online.

  Eulitz, F. (1998) Numerische Simulation und Modellierung der instationären Strömung in Turbomaschinen. Kolloquium an der Ruhr-Universität Bochum, 6. Mai 1998. Volltext nicht online.

  Eulitz, F. (1998) Numerical Simulation of Unsteady Turbomachinery Flow. eingeladener Seminarvortrag Pratt & Whitney, East Hartford, CT, USA, 17.7.98. Volltext nicht online.

  Eulitz, F. (2000) Numerische Simulation und Modellierung der instationären Strömung in Turbomaschinen. Dissertation. DLR-Forschungsbericht. 2000-05, 197 S. Volltext nicht online.

  Eulitz, F. (1995) Vorstellung des Navier-Stokes Solver TRACE, Teil 2: Turbulenz-Modellierung. Numerische Untersuchung des Clocking-Effekts in einer Turbine, MTU-Workshop, 22.09.95, MTU Muenchen. Volltext nicht online.

  Eulitz, F. (1996) Verfahrensentwicklung fuer die Berechnung von instationaeren Stroemungen in Turbomaschinen. BMW Rolls-Royce/DLR-Workshop: Rechenverfahren für Antriebe, DLR Köln-Porz, 18.03.1996. Volltext nicht online.

  Eulitz, F. (1995) Unsteady Codes & Turbulence Modelling. Workshop ONERA/DLR, ONERA-Cert, Toulouse, Frankreich, 13.-14.11.1995. Volltext nicht online.

  Eulitz, F. (1995) Numerical Simulation of Unsteady Turbomachinery Flow - Validation and Application. Workshop anlaesslich Beuch von Prof. F. Breugelmans & Mitarbeiter von VKI Bruessel, Belgien, 18.12.95, DLR Koeln-Porz. Volltext nicht online.

  Eulitz, F. (1996) Numerische Simulation der instationaeren Stroemung in Turbomaschinen. Seminarvortrag an der TH Darmstadt, 27.8.96. Volltext nicht online.

  Eulitz, F. und Engel, K. (1998) Numerical Investigation of Wake Interaction in a Low Pressure Turbine. 43. ASME Gas Turbine & Aeroengine Technical Congress, Stockholm, Schweden, 2.6.-6.6.98. Volltext nicht online.

  Eulitz, F. und Engel, K. (1996) Numerische Untersuchungen der Clocking-Effekte am Beispiel einer dreistufigen Niederdruckturbine. Workshop bei MTU Muenchen, 08.10.1996. Volltext nicht online.

  Eulitz, F. und Engel, K. (1997) Numerische Untersuchungen zum Einfluss der zeitabhaengigen reibungsbehafteten 2D-Gitterstroemung auf die zeitlichen Mittelwerte in Verdichterstufen. In: Proc. 1. Engine-3E-Workshop, MTU München, 1997. 1. Engine-3E-Workshop, MTU München, 1997. Volltext nicht online.

  Eulitz, F. und Engel, K. (1997) Numerical Investigation of Wake Interaction in a Low Pressure Turbine. In: Proc. 33rd AIAA Joint Prop. 1997. 33rd AIAA Joint Prop., 6.-9.7.97, Seattle, WA, USA, 1997. Volltext nicht online.

  Eulitz, F. und Engel, K. (1997) Computation of the Unsteady and Laminar-turbulent Flow in a Low Pressure Turbine. In: Proc. 11th Symp. on Turbulent Shear Flows 1997. 11th Symposium on Turbulent Shear Flows, Grenoble, Frankreich, 8.-11. Sept. 1997. Volltext nicht online.

  Eulitz, F. und Engel, K. und Faden, M. und Pokorny, S. (1994) Validation of TVD-Schemes for Unsteady Turbomachinery Flow. Vortrag auf der 14th International Conference on Numerical Methods in Fluid Dynamics, 11-15 July, 1994, Bangalore, India. Volltext nicht online.

  Eulitz, F. und Engel, K. und Faden, M. und Pokorny, S. (1994) Unsteady Shock-Shear Layer Interaction in a Transonic Compressor Stage. ECCOMAS 94 Conference, 5-8 Sept., Stuttgart. Volltext nicht online.

  Eulitz, F. und Engel, K. und Faden, M. und Pokorny, S. (1994) Simulation der instationaeren Wechselwirkung in einer transsonischen Verdichterstufe. Vortrag auf NEC-DLR Kolloquium "High Performance Computing", 7-8 Nov. 1994. Volltext nicht online.

  Eulitz, F. und Engel, K. und Gebing, H. (1995) Instationäre Strömungsvorgänge an der Stabilitaetsgrenze des Verdichters-Ansätze zu einer numerischen Untersuchung. MTU-Workshop: "Instationäre Strömungsvorgänge an der Stabilitätsgrenze des Verdichters", MTU München, 20.03.1995. Volltext nicht online.

  Eulitz, F. und Engel, K. und Gebing, H. (1995) Instationaere Validierung eines Eingleichungs-Turbulenzmodells am Fall der selbsterregten Stossoszillation um ein Kreisbogenprofil im ebenen Kanal. In: Prpc. 7. STAB-Workshop. 7. STAB-Workshop, 14.-16. Nov. 1995, DLR Göttingen. Volltext nicht online.

  Eulitz, F. und Engel, K. und Gebing, H. (1996) Numerische Simulation der instationaeren Stroemung in Turbomaschinenkomponenten. Teil 2: Behandlung der Turbulenz. Zentrumskolloquium, DLR-Göttingen, 1. Februar 1996. Volltext nicht online.

  Eulitz, F. und Engel, K. und Gebing, H. (1996) Application of a one-equation eddy-viscosity model to unsteady turbomachinery flow. In: Engineering Turbulence Modelling and Experiments 3 (1996) Eds.: W. Rodi, C. Bergeles, Seiten 741-751. Engineering Turbulence Modelling and Experiments 3, Editors: W. Rodi, G.Bergeles, Elsevier 1996, Proc. Heraklion+Gete,Greece,27.-29.Mai 96. Volltext nicht online.

  Eulitz, F. und Engel, K. und Gebing, H. (1996) TRACE - Das instationaere Verfahren fuer Turbomaschinenstroemungen. Statusseminar zur MTU/DLR Kooperation "Gemeinsam zur neuen Triebwerkstechnik", 25.-26.Maerz 1996. Volltext nicht online.

  Eulitz, F. und Engel, K. und Gebing, H. (1996) Numerische Simulation der instationaeren Stroemung in Turbomaschinen. In: DGLR-Jahresbericht 1996, Band 2. Vortrag: DGLR-Jahrestagung in Dresden, 26.09.1996 Proceed: DGLR-Jahresbericht. Volltext nicht online.

  Eulitz, F. und Engel, K. und Gebing, H. (1996) Numerische Simulation des instationaeren Waermeuebergangs an einem Turbinenrotor unter Einschluss von Heissstellen. Vortrag auf 13. AK-Sitzung AG-Turbotech, Koeln-Porz, 18.10.96. Volltext nicht online.

  Eulitz, F. und Engel, K. und Gebing, H. und Lisiewicz, S. (1996) Numerical Investigation of the Clocking Effects in a Multistage Turbine. In: ASME Turbo-Expo, Birmingham 1996. ASME Turbo-Expo, Birmingham, UK, 10-13 june, 1996 ASME-paper: 96-GT-26. Volltext nicht online.

  Eulitz, F. und Engel, K. und Gebing, H. und Pokorny, S. (1995) Numerical Investigation of Invisored and Viscous Interaction in a Transonic Compressor. Vortrag zum Symposium:AGARD-PEP 85th Meeting on Loss Mechanisms and Unsteady Flows in Turbomachines, Derby, U.K. 8-12 May, 1995. Volltext nicht online.

  Eulitz, F. und Engel, K. und Pokorny, S. (1) und Gebing, H. und Weyer, H. und Faden, M. (1) (1996) Entwicklung eines 3D-Stroemungsloesers auf einem Parallelprozessorsystem zur Berechnung der instationaeren Stroemung in einer Turbomaschinenstufe. DFG-Abschlußkolloquium, Bonn, 22. April 1996. Volltext nicht online.

  Eulitz, F,, und Engel, K. und Nürnberger, D. und Schmitt, S. und Yamamoto, K. (1998) On Recent Advances of a Time-Accurate Parallel Navier-Stokes Solver for Unsteady Turbomachinery Flow. Computational Fluid Dynamics 1998, Proceedings of the 4th European Computational Fluid Dynamics Conference, Athens, Greece, 8 Sept. 1998. Volltext nicht online.

  Ewert, Roland und Hartmann, R. und Held, J. und Leicht, T. und Bauer, M. und Ashcroft, G. und Weckmüller, C. und Guerin, S. und Schady, A. und Heimann, D. und Siefert, M. und Heintze, O. und Unruh, O. und Mühlbauer, Bernd und Noll, Berthold (2010) Advanced Numerical Tools Graduation for Aeronautical Research and Development. Projektbericht. Volltext nicht online.

  Eyers, C.J. und Norman, P. und Middel, J. und Plohr, M. und Michot, S. und Atkinson, K. und Christou, R.A. (2004) AERO2K Global Aviation Emissions Inventories for 2002 and 2025. Projektbericht. 04/01113, 144 S. Volltext nicht online.


  Faden, M. und Engel, K. und Pokorny, S. (1991) Parallele Implementierung eines integrierten Strömungssimulationssystems. GMB-Bonn, Forum "KEply" Konzepte und Einsatz paralleler Systeme 1991, 10.04.91. Volltext nicht online.

  Faden, M. und Engel, K. und Pokorny, S. (1991) Ein interaktives Simulationssystem für instationäre Strömungen auf Transputersystemen. Vortrag Universität Bonn, 26.11.91. Volltext nicht online.

  Faden, M. und Engel, K. und Pokorny, S. (1993) Unsteady Flow Simulation on a Parallel Computer. AIAA Computational Fluid Mechanics Conference, Orlando, Fl, 1993, USA. Volltext nicht online.

  Faden, M. und Pokorny, S. und Engel, K. (1991) An integrated flow simulation system on a parallel computer part II, The Flow Solver. 7th International Conference on Numerical Methods in Laminar and Turbulent Flow. Volltext nicht online.

  Faden, M. und Pokorny, S. und Engel, K. (1991) Parallele Implementierung eines integrierten Strömungssimulationssystems. GAMM-Seminar "Numerische Algorithmen auf Transputersystemen", Heidelberg, Juni 1991. Volltext nicht online.

  Faden, M. und Pokorny, S. und Engel, K. (1991) Implementierung eines interaktiven Strömungssimulationssystems, Teil 2. GAMM Seminar "Numerische Algorithmen auf Transputersystemen", Juni 1991, Heidelberg. Volltext nicht online.

  Faden, M. und Pokorny, S. und Engel, K. (1991) An Integrated Flow Simulation System on a Parallel Computer, Part II: The Flow Solver. 7th International Conference on Numerical Methods in Lamiunar and Turbulent Flow. Volltext nicht online.

  Faden, M. und Pokorny, S. und Engel, K. (1991) Integriertes Strömungssimulationssystem auf einem Prallelrechner, Teil 2: Der Strömungslöser. Seminarvortrag IWR Heidelberg. Volltext nicht online.

  Faden, M. und Pokorny, S. und Engel, K. (1992) A CFD Application on Transputer Systems. GAMM Seminar, Heidelberg. Volltext nicht online.

  Faden, M. und Schimming, P. (1991) Strömungsanalysewerkzeuge in der Turbomaschinenforschung und Berechnung der instationären Strömung auf Parallelrechnern. Seminarvortrag in München bei der MTU, 16.10.91. Volltext nicht online.

  Faden, M. und Engel, K. und Pokorny, S. (1992) TVD-Verfahren fuer instationaere Stroemungssimulation auf Transputern. Kolloquium Stroemungsmaschinen Universität Essen, 29.06.1992, Essen. Volltext nicht online.

  Faden, M. und Engel, K. und Pokorny, S. (1992) Instationaere Stroemungssimulation in Triebwerkskomponenten auf massiv parallelem Rechnersystem. Seminarvortrag GMB-Bonn, Bonn. Volltext nicht online.

  Faden, M. und Engel, K. und Pokorny, S. (1992) Numerische Simulation von Triebwerksstroemungen auf parallenen Rechnersystemen. COMETT Seminar, Industrielle Anwendung paralleler Computersysteme, Graz, Österreich. Volltext nicht online.

  Faden, M. und Pokorny, S. und Engel, K. (1992) Numerische Simulation von Triebwerksstroemungen auf parallelen Rechnersystemen. COMETT Seminar, Industrielle Anwendung paralleler Computersysteme, Graz, Oesterreich. Volltext nicht online.

  Faden, M. und Pokorny, S. und Engel, K. (1992) Instationaere Triebwerksstroemungen. Seminarvortrag, Universitaet Dortmund, Dortmund. Volltext nicht online.

  Fehse, K.-R. (1997) Experimentelle Untersuchungen zur Entstehung tieffrequenter Druckschwankungen bei Radialventilatoren. Dissertation. Volltext nicht online.

  Fehse, K.-R. und Neise, W. (1995) Entstehungsursachen tieffrequenter Druckschwankungen bei Radialventilatoren II. DLR-Interner Bericht. 92517-95/B6, 161 S. Volltext nicht online.

  Fiala, R. und Dussa, K. (1990) Ueber Schaeume zur Loeschung von Fluessigkeitsbraenden. DLR-Interner Bericht. 325-04/90. Volltext nicht online.

  Fischer, Andre und Bake, Friedrich und Heinze, Johannes und Diers, Olaf und Willert, Christian und Röhle, Ingo (2008) Off-line phase-averaged particle image velocimetry and OH chemiluminescence measurements using acoustic time series. Measurement Science and Technology, 20 (7). IOP. Volltext nicht online.

  Fischer, M. (1992) Eine Einschaetzung des Status der Temperatur-Messgenauigkeit mit Laser-Induzierter Fluoreszenz (LIF) und der Einsatzmoeglichkeit von LIF am Brennkammer-Duesen-Pruefstand der DLR-KP. DLR-Interner Bericht. 325-01-92. Volltext nicht online.

  Fischer, M. (1992) Eine Einschaetzung des Status der Temperatur-Messgenauigkeit mit Laserinduzierter Fluoreszenz (LIF) und der Einsatzmoeglich- keit von LIF am Brennkammer-Duesenpruefstand der DLR-KP. DLR-Interner Bericht. 325-01-92. Volltext nicht online.

  Fischer, M. (1993) Temperature measurements in H2 flames. In: Vortrag bei dem DLR/ONERA Kooperationstreffen "Optical Diagnostics for HERMES TESTING Facilities", DLR Goettingen, 8.02.1993. Volltext nicht online.

  Fischer, M. (1993) CARS-Temperaturmessungen in H2-Flammen. Vortrag auf dem LIFG-Treffen, DLR Koeln, 17.-18.5.93. Volltext nicht online.

  Fischer, M. (1993) N2 and H2O CARS thermometry for RAM and SCRAM jet combustion chambers. DLR-Onera Kooperationstreffen, LAERTE/ONERA-Palaiseau, 7.12.1993. Volltext nicht online.

  Fischer, M. (1994) N2- und H2O-CARS-Einzelpulsmessungen in planarer BOX-CARS-Konfiguration an der mit H2 und Luft betriebenen Brennkammer des BDP-A. Abschlusstreffen zur Messkampagne am BDP-A, Institut fuer Antriebstechnik, DLR-Koeln, 23.-24. Febr. 1994. Volltext nicht online.

  Fischer, M. (1994) N2-CARS im Graphitofen. LIF 7 Meeting, DLR-Stuttgart, 17.-18.10.1994. Volltext nicht online.

  Fischer, M. (1994) CARS on N2 and H2O-selected results 1994. DLR/ONERA Kooperationstreffen, DLR-Lampoldshausen, 14.-15.11.1994. Volltext nicht online.

  Fischer, M. (1995) Cars at the DLR-Cologne - New Results 1995. DLR/ONERA Kooperationstreffen, ONERA-Palaiseau, 19.-20. Juni 1995,. Volltext nicht online.

  Fischer, M. (1996) CARS activities at the DLR-Cologne. DLR/ONERA Kooperationstreffen, DLR-Goettingen, 25.-25.6.1996. Volltext nicht online.

  Fischer, M. (1996) Zur N2-CARS-Thermometrie in H2-Luft Flammen bei Druecken bis 10 bar. LIF-Treffen, DLR Koeln, 18.-19. Juni 1996. Volltext nicht online.

  Fischer, M. und Heinze, J. und Matthias, K. und Röhle, I. (2000) Doppler Global Velocimetry in flames using a newly developed, frequency stabilized, tunable, Long pulse, Nd: YAG Laser. 10th International Symposium on Applications of Laser Techniques to Fluid Mechanics, Session 35, Lisbon, Portugal, July 10-13, 2000. Volltext nicht online.

  Fischer, M. und Heinze, J. und Matthias, K. und Röhle, I. (2001) Doppler Global Velocimetry in an atmospheric kerosene spray combustor using a newly developed, frequency stabilized, tunable, long pulse ND:YAG laser. 20th European CARS Workshop, Institute of Technology, University Lund, Schweden, April 1-3, 2001. Volltext nicht online.

  Fischer, M. und Magens, E. und Schodl, R. und Stursberg, K. und Winandy, A. (1990) Projected Car Measurements on a Ram-Jet Nozzle at the DLR Cologne. Ninth European Cars Workshop, 19-20 March 1990, Dijon, France.. Volltext nicht online.

  Fischer, M. und Magens, E. und Schodl, R. und Stursberg, K. und Winandy, A. (1991) CARS status at the DLR Cologne. In: Proc. Techn. European CAS Workshop 1991. Technical European CAS Workshop, MPI, Institut für Quantenoptik, Garching, 18.-19.03.1991. Volltext nicht online.

  Fischer, M. und Magens, E. und Weisgerber, H. und Winandy, A. und Cordes, S. (1998) CARS temperature measurements on an air breathing ramjet model. 36th Aerospace Sciences Meeting and Exhibit, Reno, NV, January 12-15, 1998. Volltext nicht online.

  Fischer, M. und Magens, E. und Weisgerber, H. und Winandy, A. und Cordes, S. (1999) Coherent Anti-Stokes Raman Scattering Temperature Measurements on an Air Breathing Ramjet Model. AIAA Journal, 37 (6), Seiten 744-750. Volltext nicht online.

  Fischer, M. und Magens, E. und Winandy, A. (1992) Single-shot broadband nitrogen CARS measurement with temperatures up to 2900 K; Comparison of different data evaluation schemes. Posterpraesentation auf dem XI' th European CARS Workshop Florenz, 23.-25.k03.92. Volltext nicht online.

  Fischer, M. und Magens, E. und Winandy, A. (1994) N2- und H2O-CARS-Einzelpulsmessungen in planarer BOX-CARS-Konfiguration an der mit H2 und Luft betriebenen Brennkammer des BDP-A. DLR-Interner Bericht. 325-12-94, 20 S. Volltext nicht online.

  Fischer, M. und Magens, E. und Winandy.A., (1994) N2- und H2O-Cars-Einzelpulsmessungen in planarer BOX-CARS-Konfiguration an der mit H2 u. Luft begtriebenen Brennkammer des BDP-A. DLR-Interner Bericht. 325-08-94, 17 S. Volltext nicht online.

  Fischer, M. und Stockhausen, G. und Heinze, J. und Seifert, M. und Mueller, M. und Schodl, R. (2004) Development of Doppler Global Velocimetry(DGV)measurement devices and combined application of DGV and OH*-chemiluminescence imaging to gas turbine combustor. In: Proceedings. <12th Intern.Symp.on Applications of Laser Techniques to Fluid Mechanics,12-15 July,2004,Lisbon,Portugal. Volltext nicht online.

  Fischer, M. (1992) CARS-Aktivitaeten bei der DLR-Koeln. LIF 5 Meeting, 27.-28.09.1992, Lampoldshausen. Volltext nicht online.

  Fischer, M. (1992) First N2-measurements up to approximately 3100 K at the DLR- Cologne. Meeting HERMES diagnostic group, , 24.02.92, Köln-Porz. Volltext nicht online.

  Fischer, M. und Magens, E. und Winandy, A. (1992) Single-shot broadband nitrogen CARS measurements with temperature up to 3200K: Comparison of different data evaluation shemes. In: World Scientific Publishing Co Pte Ltd, Singapore. XI`th European CARS Workshop, 23.-25.03.1992, Florence, Italy. Volltext nicht online.

  Fischer, Michael (2006) Untersuchungen zur Einsatzfähigkeit der N<sub>2</sub> - und H<sub>2</sub>O-CARS-Thermometrie und H<sub>2</sub>O-CARS-Konzentrationsmessung bei der Analyse von H<sub>2</sub>-Staustrahltriebwerken. Dissertation, Technische Universität Berlin. Volltext nicht online.

  Fischer, Michael und Heinze, Johannes und Müller, Martin und Diers, Olaf und Schneider, Denis (2007) Optical Diagnostics on a Catalytic Burner. In: 2007 DLR-ONERA MOTAR Meeting. Selbstverlag ONERA-Meudon. MOTAR Meeting 2007, 2007-04-03 - 2007-04-04, Paris Meudon (Frankreich). Volltext nicht online.

  Fischer, Michael und Magens, Eggert und Weisgerber, Hedwig und Winandy, Adi und Cordes, Sebastian (1999) Coherent Anti-Stokes Raman Scattering Temperature Measurements on an Air Breathing Ramjet Model. AIAA Journal, 37 (6), Seiten 744-750. AIAA. Volltext nicht online.

  Fischer, Michael und Magens, Eggert und Winandy, Adi (1995) N<sub>2</sub> and H<sub>2</sub>O thermometry at high pressure and temperature. XIV´th European CARS Workshop, [1995-03-29 - 1995-03-31], El Escorial, Spanien. Volltext nicht online.

  Fischer, Michael und Magens, Eggert und Winandy, Adi (1994) Nitrogen and water CARS measurements in planar BOX-CARS configuration at the exit of a ram jet combustion chamber. XIII'th European CARS Workshop, [1994-03-21 - 1994-03-22], Gif sur Yvette, La Terrasse (France). Volltext nicht online.

  Fischer, Michael und Heinze, Johannes und Müller, Martin und Diers, Olaf und Schneider, Dennis (2008) Optical diagnostics on a catalytic burner. ECONOS 2008 / microCARS 2008, 2008-05-25 - 2008-05-27, Igls (Austria). Volltext nicht frei. file

  Fischer, Michael und Magens, Eggert und Koch, Uwe und Esser, Burkard und Gülhan, Ali (2016) Development and application of an improved CARS set-up for the characterization of high enthalpy flow fields. DIVA12 – Diagnostik in Verbrennung und Aerodynamik, 12.-13. Okt. 2016, Berlin –Charlottenburg. (nicht veröffentlicht) Volltext nicht online.

  Fleing, Ch. (1998) Phänomenstudium an der mageren Verlöschgrenze von drallstabilisierten Kerosin-Flammen. Diplomarbeit. DLR-Interner Bericht. Volltext nicht online.

  Foerster, W. (1994) Laser Two Focus Velocimetry Applied to TsAGI's Supersonic Combustor Test Rig T 131. 3rd Working Group meeting &quot;Scramjet Technology&quot;. Volltext nicht online.

  Foerster, W. (1995) Laser Two Focus Velocimetry Applied to TsAGI's Supersonic Combustor Test Rig T 131. TsAGI International Workshop on Scramjet Technology, Zhukovsky, Russia. Volltext nicht online.

  Foerster, W. und Schodl, R. (1991) Neue Entwicklungen beim Laser-2-Fokus-Verfahren in Turbomaschinen. In: Jahrbuch 1991 der DGLR. DGLR-Jahrestag 1991, 10.-13.09.91 in Berlin. Volltext nicht online.

  Foerster, W. und Schodl, R. (1994) Auswahl und Anwendung laseroptischer Messverfahren an SCRAMJET-Brennkammern bei TsAGI (GUS). DLR-Interner Bericht. 325-04-94, 7 S. Volltext nicht online.

  Foerster, W. und Schodl, R. (1996) SCRAMJET-Technologie. Messtechnik, Auswahl und Anwendung laseroptischer Messverfahren an SCRAMJET-Brennkammern bei TsAGI (GUS). DLR-Interner Bericht. 325-02-96, 272 S. Volltext nicht online.

  Fradin, C. und LeGuevel, A. und Guernigon, J. und Billonnet, C. und Röhle, I. (1999) Application de la tomoscopie laser à la localisation des configurations des ondes de choc dans le coupes des canaux interaubes des compresseurs axiaux transsoniques. Projektbericht, DLR-Interner Bericht. Volltext nicht online.

  Frank, P. und Tan, Y. und Griebel, P. und Nannen, H. und Eickhoff, H. (1996) Analysis of NO-Formation for Rich/Lean-Staged Combustion. In: 3rd Workshop on Modelling Chem. Systems. 3rd Workshop on Modelling Chem. Systems, Heidelberg, 1996. Volltext nicht online.

  Freitag, Stefan und Ulrich, Meier und Johannes, Heinze und Thomas, Behrendt und Christoph, Hassa (2010) Measurement of Initial Conditions of a Kerosene Spray from a Generic Aeroengine Injector at Elevated Pressure. ILASS – Europe 2010 23rd Annual Conference on Liquid Atomization and Spray Systems, 06.-08. Sept. 2010, Tschechische Republik, Brünn. ISBN 978-80-7399-997-1 Volltext nicht online.

  Frenk, A. (1991) Triebwerksmodellierung für ein Staustrahltriebwerk mit Überschallverbrennung im Machzahlbereich 5 bis 15. DLR-Interner Bericht. 325-13-91, 128 S. Volltext nicht online.

  Freund, Oliver und Rehder, Hans-Juergen und Schäfer, Philipp und Röhle, Ingo (2011) Experimental Investigations on Cooling Air Ejection at a Straight Turbine Cascade Using PIV and QLS. ASME Turbo Expo 2011, 6.-10.Juni 2011, Vancouver, Kanada. Volltext nicht online.

  Frey, Christian und Ashcroft, Graham und Kersken, Hans-Peter und Weckmüller, Christian (2012) Advanced Numerical Methods for the Prediction of Tonal Noise in Turbomachinery, Part II: Time-Linearized Methods. ASME TurboExpo 2012, 11.-15. Juni 2012, Kopenhagen, Dänemark. Volltext nicht online.

  Frey, Christian und Kersken, Hans-Peter und Voigt, Christian und Ashcroft, Graham (2012) Time-Linearized and Time-Accurate 3D RANS Methods for Aeroelastic Analysis in Turbomachinery. Journal of Turbomachinery, 134 (5). American Society of Mechanical Engineers (ASME). DOI: 10.1115/1.4004749 ISSN 0889-504X Volltext nicht online.

  Frey, Christian (2014) Physical Interpretation of Discrete and Continuous Adjoint Boundary Conditions. Dagstuhl Seminar 14371: Adjoint Methods in Compuational Science, Engineering and Finance, 07.-12. Sep. 2014, Leibniz Zentrum für Informatik, Schloss Dagstuhl, Deutschland. (nicht veröffentlicht) Volltext nicht online.

  Frey, Christian und Ashcroft, Graham und Kersken, Hans-Peter und Voigt, Christian (2014) A Harmonic Balance Technique for Multistage Turbomachinery Applications. ASME Turbo Expo 2014, 16.-20. Juni 2014, Düsseldorf, Deutschland. Volltext nicht online.

  Frey, Christian und Ashcroft, Graham und Kersken, Hans-Peter und Voigt, Christian (2015) Simulations of Unsteady Blade Row Interactions using Linear and Non-linear Frequency Domain Methods. In: JOURNAL OF ENGINEERING FOR GAS TURBINES AND POWER-TRANSACTIONS OF THE ASME. ASME Turbo Expo 2015: Turbine Technical Conference and Exposition, 15.-19. Jun. 2015, Montreal, Kanada. Volltext nicht online.

  Frey, Christian und Kersken, Hans-Peter (2014) A hybrid mesh linear harmonic solver for the aeroelastic analysis of turbomachinery. 6th. European Conference on Computational Fluid Dynamics - ECFD VI, 20.-25. Juli 2014, Barcelona, Spanien. file

  Fuchs, R. (1990) Design and Experimental Investigation of a Supercritical Compressor Rotor Blade Section. Institute of Thermophysics Academia Sinica, 10 October 1990, Bei, PR China; Gas Turbine Establishment, 17 October 1990, Jiangyou, PR China. Volltext nicht online.

  Fuchs, R. (1991) Transonic Compressor Cascade Flow with Shock Induced Boundary Layer Separation. Euromech 274, Prag, 08.-11.04.91 Videofilm!. Volltext nicht online.

  Fuchs, R. und SChreiber, H.A. (1995) Entwicklung einer Enturfsmethode fuer transsonische Axialverdichtergitter. Projektbericht, DLR-Interner Bericht. Volltext nicht online.

  Fuchs, R. und Schreiber, H. A. (1995) Entwicklung einer Entwurfsmethode für transsonische Axialverdichtergitter. Projektbericht, DLR-Interner Bericht. Zwischenbericht II/94 AG-Turbo 1995, 6 S. Volltext nicht online.

  Fuchs, R. und Schreiber, H. A. und Steinert, W. und Küsters, B. (1998) Ein verlustminimiertes Verdichtergitter für einen transsonischen Rotor - Entwurf und Analyse. VDI Düsseldorf. VDI-GET Tagung, Hannover, 6.-7. Okt. 1998. Volltext nicht online.

  Fuchs, R. und Schreiber, H.A. (1993) Entwicklung einer Entwurfsmethode fuer transsonische Axialverdichtergitter, Zwischenbericht 1/93 zum AG-Turbo/TURBOTECH Vorhaben &quot;Hochtemperatur-Gasturbine&quot;. Projektbericht, DLR-Interner Bericht. Volltext nicht online.

  Fuchs, R. und Schreiber, H.A. (1994) Entwicklung einer Entwurfsmethode fuer transsonische Axialverdichtergitter. Projektbericht, DLR-Interner Bericht. Halbjahresbericht 1/94, AG-Turbo, 7 S. Volltext nicht online.

  Fuchs, R. und Schreiber, H.A. (1995) Entwicklung einer Entwurfsmethode fuer transsonische Axialverdichtergitter. Vortrag 11. AK-Sitzung TURBOTECH, 16.10.1995, Koeln-Porz, DLR. Volltext nicht online.

  Fuchs, R. und Schreiber, H.A. (1996) Entwicklung einer Entwurfsmethode fuer transsonische Axialverdichtergitter. Projektbericht, DLR-Interner Bericht. Volltext nicht online.

  Fuchs, R. und Schreiber, H.A. und Starken, H. (1993) Entwicklung einer Entwurfsmethode fuer transsonische Axialverdichter-gitter. Postervortrag auf der Arbeitskreissitzung AG-Turbo-TURBOTECH Koeln 14.-15.10.1993. Volltext nicht online.

  Fuchs, R. und Schreiber, H.A. und Starken, H. (1993) Entwicklung einer Entwurfsmethode für transsonische Axialverdichtergitter. sonstiger Bericht. Volltext nicht online.

  Fuchs, R. und Schreiber, H.A. und Steinert, W. (1996) Auslegung und experimentelle Untersuchung des transsonischen Rotorgitters TAGT 1.2. DLR-Interner Bericht. 325-08-96, 136 S. Volltext nicht online.

  Fuchs, R. und Schreiber, H.A. und Steinert, W. (1996) Auslegung und experimentelle Untersuchung des transsonischen Rotorgitters DLR-TAGT 1.2. DLR-Interner Bericht. bitte Löschen-doppelt. Volltext nicht online.

  Fuchs, R. und Schreiber, H.A. und Weber, A. und Steinert, W. (1998) Räumliche Strömungen in transsonischen Verdichtergittern. Turbotech Arbeitskreissitzung, Köln, 15.-16.10.1998. Volltext nicht online.

  Fuchs, R. und Steinert, W. und Starken, H. (1993) Transonic Compressor Rotor Cascade with Boundary-Layer Separation: Experimental and Theoretical Results. The American Society of Mechanical Engineers, NEW York, USA. International Gas Turbine and Aeroengine Congress and Exposition Cincinnaiti,Ohio, May 24-27, 1993, ASME Paper 93-GT-405. Volltext nicht online.

  Fuchs, R. und Weber, T. (1997) Raeumliche Stoemungen in transsonischen Verdichtergittern sehr hoher Belastung. 15. AK-Sitzung TURBOTECH, 23.10.1997, DLR Koeln-Porz. Volltext nicht online.

  Fuchs, S. (1991) Strömung durch ein transsonisches Verdichtergitter mit stoßinduzierter Grenzschichtablösung. Institutsseminar, Köln, 14.05.91 Videofilm!. Volltext nicht online.

  Förster, W. (1995) Laser-2-Focus Data Analysis Using a Non Linear Regression Model. 16th International Congress on Instrumentation in Aerospace Simulation Facilities, July 18-21, 1995, Dayton, Ohio, USA. Volltext nicht online.

  Förster, W. und Beversdorff, M. und Karpinski, G. und Schodl, R. (2001) 3D-Laser Messungen im mehrstufigen Niederdruck-Turbinenrigg und Analyse. Abschlussbericht 1996-2000 AG-TURBO, Turbotech II, Teilprojekt 1,423, Fachkennzeichen:0327040B. Projektbericht, DLR-Interner Bericht. 325-05-01. Volltext nicht online.

  Förster, W. und Beversdorff, M. und Seifert, M. (2003) Lasermessungen am LARGE SCALE TURBINE RIG bei der ILA in Stuttgart. Projektbericht, DLR-Interner Bericht. DLR-IB-325-14-03, 57 S. Volltext nicht online.

  Förster, W. und Karpinski, G. und Beversdorff, M. und Röhle, I. und Schodl, R. (2000) 3-Komponenten Strömungsuntersuchungen mittels der Doppler-Laser-2-Fokus Technik in einem transsonischen Radialverdichter. In: Lasermethoden in der Strömungsmesstechnik, 8. Fachtagung, GALA, 13.1-13.6. Shaker Verlag. Lasermethoden in der Strömungsmesstechnik, 8. Fachtagung, Freising/Weihenstephan, 12.-14.September 2000. ISBN 3826578090 Volltext nicht online.

  Förster, W. und Karpinski, G. und Beversdorff, M. und Röhle, I. und Schodl, R. (2000) 3D-Lasermessungen im mehrstufigen Niederdruckturbinenrig und Analyse. AG Turbo, 21. AK-Sitzung, Köln, 12.-13. Oktober 2000. Volltext nicht online.

  Förster, W. und Schodl, R. (1995) Auswahl und Anwendung laseroptischer Meßverfahren an SCRAMJET-Brennkammern bei TsAGI (GUS). DLR-Interner Bericht. 325-02-95, 13 S. Volltext nicht online.

  Förster, W. und Schodl, R. und Beversdorff, M. und Klemmer, A. und Rijmenants, E. (1990) Design and Experimental Verification of 3-D Velocimeters Based on the Laser-2-Focus Technique. In: Proc. of the 5th Int. Symp. on Application of Laser Technique to Fluid Mechanics, 9-12 July 1990 (1990). Volltext nicht online.

  Führer, Tanja und Görtz, Stefan und Abu-Zurayk, Mohammad und Ilic, Caslav und Keye, Stefan und Banavara, Nagaraj und Kruse, Martin und Brodersen, Olaf und Liepelt, René und Becker, Richard-Gregor und Bach, Tobias und Jepsen, Jonas und Ciampa, Pier Davide und Kohlgrüber, D. und Scherer, Julian und Kier, Thiemo und Leitner, Martin und Siggel, Martin (2014) Entwicklung einer Softwareplattform für die Multidisziplinäre Optimierung eines Gesamtflugzeugs. 63. Deutscher Luft- und Raumfahrtkongress 2014, 16.-18. Sept. 2014, Augsburg, Deutschland. Volltext nicht frei. filefile


  Gallrein, V. (1996) Bildkalibrierung zur Erzeugung von Doppler-Global-Velocimeter Geschwindigkeitsbildern. DLR-Interner Bericht. 325-11-96, 103 S. Volltext nicht online.

  Gardner, R.M. und Adams, J.K. und Cook, T. und Larson, L.G. und Falk, R.S. und Fleuti, E. und Förtsch, W. und Lecht, M. und Lee, D.S. und Leech, M.V. und Lister, D.H. und Massé, B. und Morris, K. und Newton, P.J. und Owen, A. und Parker, E. und Schmitt, A. und ten Have, H. und Vandenberghe, C. (1998) NICHT SPEZIFIZIERT In: Aircraft Emissions - Inventories for 1991/92 and 2015 Report produced by ECAC/ANCAT and EC Working Group. ISBN 92-828-2914-6. Volltext nicht online.

  Gawehn, Thomas und Schodl, Richard (2007) A planar Mie scattering visualization technique for turbo machinery application. Measurement Science and Technology, 18 (12), Seiten 3688-3696. Institut of Physics (IOP) Publishing. DOI: 10.1088/0957-0233/18/12/003 Volltext nicht online.

  Gebing, H. (1995) Analyse instationärer Strömungsfelder. München, 22.09.1995. Volltext nicht online.

  Gebing, H. und Engel, K. und Eulitz, F. (1996) Numerical Analysis of the Unsteady Flow Fields in a Multistage Turbine. In: Proc. 15th Int. Conference on Numerical Methods in Fluid Dynamics 1996. 15th International Conference on Numerical Methods in Fluid Dynamics (ICNMDFD), June 24-28, 1996, Monterey, California. Volltext nicht online.

  Gebing, H. und Engel, K. und Eulitz, F. (1996) Analysis of Complex Unsteady Flow Fields in Turbomachinery Aerodynamics. In: Proceedings ECCOMAS '96 (1996). ECCOMAS 96, Paris, 9-13. Sept., 1996. Volltext nicht online.

  Gebing, H. und Eulitz, F. und Engel, K. (1996) Analyse und Komprimierung instationaerer Stroemungsfelder der numerischen und experimentellen Simulation. 10. DGLR-Fach-Symposium &quot;Stroemungen mit Abloesung&quot;, 11-13. Nov. 1996 Braunschweig. Volltext nicht online.

  Geiser, Georg und Wellner, Jens und Kügeler, Edmund und Weber, Anton und Moors, Anselm (2018) On the Simulation of unsteady Turbulence and Transition Effects in a Multistage Low Pressure Turbine, Part II: Full-Wheel Simulation. In: Proceedings of the ASME Turbo Expo. ASME 2018 Turbo Expo, 11.-15.Juni 2018, Oslo, Norwegen. Volltext nicht online.

  Geisler, Reinhard und Schröder, Andreas und Willert, Christian und Elsinga, Gerrit (2009) Investigation of vortex-generators within a turbulent boundary layer flow using time-resolved tomographic PIV. 3rd AEROCHINA2 Workshop on Multi-physics and Policy Meeting EU-China on RTD Collaboration in Aeronautics, 23.9.2009, Brüssel (Belgien). Volltext nicht online.

  Ghanipour, A. (2004) Experimentelle Bestimmung der Grenzschichtparameter von spanabhebend gefertigten Oberflächen und numerische Modellierung. DLR-Interner Bericht, Projektbericht. 225-2004 A 03A, 190 S. Volltext nicht online.

  Gierens, Klaus und Braun-Unkhoff, Marina und Le Clercq, Patrick und Plohr, Martin und Schlager, Hans und Wolters, Florian (2016) Condensation trails from biofuels/kerosene blends scoping study. [sonstige Veröffentlichung] file

  Gieß, P. und Kost, F. (2003) Transition and Passage Loss Determination within Three Turbine Cascades. Appendix A. DLR-Interner Bericht. 225-2002 C 02A, 138 S. Volltext nicht online.

  Gieß, P.-A. (2001) Experimental Investigations of the Flow Field within Two Improved Turbine Cascades Designed by Honda. DLR-Interner Bericht, Projektbericht. 225-2001 C 04, 69 S. Volltext nicht online.

  Gieß, P.-A. (2001) Experimental Investigations of the Flow Field within Two Improved Turbine Cascades Designed by Honda. Appendix B. DLR-Interner Bericht, Projektbericht. 225-2001 C 04B, 84 S. Volltext nicht online.

  Gieß, P.-A. (2001) Experimental Investigations of the Flow Field within Two Improved Turbine Cascades Designed by Honda. Appendix A. DLR-Interner Bericht, Projektbericht. 225-2001 C 04A, 84 S. Volltext nicht online.

  Gieß, P.-A. (2004) Systematische Untersuchungen an einer film-gekühlten Turbinenplattform mit anschließen-der Optimierung der Ausblasekonfiguration. 9. Statusseminar der AG TURBO, 1. - 2.12.2004, Köln. Volltext nicht online.

  Gieß, P.-A. und Kost, F. und Dannhauer, A. (2000) Transsonische Strömung in einem Gasturbinenlaufrad - experimentelle Untersuchungen im ebenen Gitter und im rotierenden Ringgitter. Forschung im Ingenieurwesen, 66 (3), Seiten 107-120. Volltext nicht online.

  Gieß, P.-A. und Rehder, H.-J. und Kost, F. (2000) A new test facility for probe calibration offering independent variation of Mach and Reynolds number. The XVth Bi-Annual Symposium on Measuring Techniques in Transonic and Supersonic Flow in Cascades and Turbomachines, Florence, 21.-22. September 2000, Florenz. Volltext nicht online.

  Gieß, P.-A. und Rehder, H.-J. und Willburger, A. (2003) Überprüfung der Kalibration der Keilsonde KWU1. DLR-Interner Bericht. 225-2003 C 05, 62 S. Volltext nicht online.

  Gieß, P.-A. und Tiedemann, M. (2002) Experimental Investigation of the Flow Field within Two Turbine Cascades Designed by Alstom. DLR-Interner Bericht. 225-2002 C 03, 73 S. Volltext nicht online.

  Giodano, D. und Willert, C. und Grammartini, S. und Gallodoro, R. (2002) PIV Post Processing Methods Applied on High Turbulent GT Burner Flames. 25th Event of the Italian Section of the Combustion Institute: &quot;Combustion and Sustainable Development&quot;, Roma, June 3-5, 2002.. Volltext nicht online.

  Giuliani, F. und Becker, J. und Hassa, C. (2004) Investigation of vapour phase issued from an air-blast injector with swirl cup using the VIS-IR extinction technique. DLR/ONERA AnnexII Meeting, Köln, 6-7.4.2004. Volltext nicht online.

  Giuliani, F. und Berthoumieu, P. und Becker, J. und Hassa, C. (2004) The effect of ambient air pressure on planar liquid sheet disintegration at gas-turbine conditions. In: 19th. ilass Europe'04, 19, Seiten 68-75. AlphaGraphics, Nottingham. 19. Int. Conf. on Liquid Atomization and Spray Systems, Nottingham, 6-8.9.2004. Volltext nicht online.

  Giuliani, F. und Gajan, P. und Biscos, Y. und Diers, O. und Ledoux, M. (2001) Analyse de L'écoulement diphasique généré par un injecteur de type aérodynamique en régime pulsatoire forcé. 9ième Congrès FLUVISU, Rouen, France, June 18-21, 2001. Volltext nicht online.

  Giuliani, F. und Gajan, P. und Diers, O. und Ledoux, M. (2002) Influence of pulsed air entries on a spray generated by an air-blast injection device : an experimental analysis on combustion instability process in aeroengines. In: Proceedings of the Combustion Institute the Combustion Institute. Volltext nicht online.

  Giuliani, F. und Gajan, P. und Diers, o. und Ledoux, M. (2001) Analyse en moyenne de phase du champ de vitesse de l'air issue d'un injecteur aérodynamique en régime pulsatoire forcé. 15ième Congrès Francaise de Mécanique, Nancy, France, September 3-7, 2001. Volltext nicht online.

  Giuliani F., und Diers O., und Gajan P., und Ledoux M., (2002) Characterisation of an air-blast injection device with forced periodic entries. In: IUTAM Symposium on Turbulent Mixing and Combustion Kluwer Academic Publishers. ISBN 1-4020-0747-7. Volltext nicht online.

  Giuliani, F, und Becker, J, und Hassa, C, (2004) Investigation of vapour phase. Projektbericht, DLR-Interner Bericht. 325-04-04, 55 S. Volltext nicht online.

  Giuliani, F, und Hassa, C, (2003) Status Report - Droplet Size Measurements. Projektbericht, DLR-Interner Bericht. 325-11-03, 69 S. Volltext nicht online.

  Goinis, Georgios (2018) Entwicklung und Anwendung von modernen optimierungsfähigen Auslegungsverfahren unter Berücksichtigung des Realgaseinflusses : Forschungsvorhaben 03ET7040R Verbundvorhaben COOREFLEX-turbo Teilvorhaben 1.2.4d. Projektbericht. file

  Grewe, Volker und Stenke, Andrea und Plohr, Martin und Korovkin, Vladimir D. (2010) Climate functions for the use in multi-disciplinary optimisation in the pre-design of supersonic business jet. The Aeronautical Journal, 114 (1154), Seiten 259-269. Cambridge University Press. ISSN 0001-9240 Volltext nicht frei. file

  Grewe, Volker und Dahlmann, Katrin und Flink, Jan und Frömming, Christine und Ghosh, Robin und Gierens, Klaus Martin und Heller, Romy und Hendricks, Johannes und Jöckel, Patrick und Kaufmann, Stefan und Kölker, Katrin und Linke, Florian und Luchkova, Tanja und Lührs, Benjamin und van Manen, Jesper und Matthes, Sigrun und Minikin, Andreas und Niklaß, Malte und Plohr, Martin und Righi, Mattia und Rosanka, Simon und Schmitt, Angela Rebecca und Schumann, Ulrich und Terekhov, Ivan und Unterstrasser, Simon und Vazquez-Navarro, Margarita und Voigt, Christiane und Wicke, Kai und Yamashita, Hiroshi und Zahn, Andreas und Ziereis, Helmut (2017) Mitigating the Climate Impact from Aviation: Achievements and Results of the DLR WeCare Project. Aerospace, 4 (3), Seiten 1-50. Multidisciplinary Digital Publishing Institute (MDPI). DOI: 10.3390/aerospace4030034 ISSN 2226-4310 file

  Grewe, Volker und Plohr, Martin und Cerino, G. und Di Muzio, M. und Deremaux, Yann und Galerneau, M. und de Staint Martin, P. und Chaika, T und Hasselrot, A. und Tengzelius, Ulf und Korovkin, Vladimir D. (2010) Estimates of the climate impact of future small-scale supersonic transport aircraft – results from the HISAC EU-project. The Aeronautical Journal, 114 (1153), Seiten 199-206. Cambridge University Press. ISSN 0001-9240 file

  Grewe, Volker und Plohr, Martin und Cerino, Gerino und Di Muzio, Massimiliano und Deremaux, Yann und de Saint Martin, Philippe und Chaika4, Taras und Hasselrot5, Anders und Tengzelius5, Ulf und Korovkin, Vladimir (2009) Small-scale supersonic transport aircraft (S4TA): HISAC project. Transport Atmosphere and Climate TAC-2, 22.-25. Juni 2009, Aachen, Germany. file

  Griebel, P. (1994) Messtechnik fuer die experimentelle Untersuchung von schadstoffarmen Gasturbinenbrennkammern. In: Minutes des Workshops zur Schadstoffenstehung-, umwandlung- und ausbreitung von der Brennkammer bis zum Zerfall der Wirbelschuppe, Schad. stoffe in der Luftfahrt, 2/94, Stuttgart. Volltext nicht online.

  Griebel, P. (1996) Experimentelle Untersuchung eines atmosphaerischen Fett-Mager-Brennkammersektors fuer Flugtriebwerke. Kolloquium Energietechnik, Universitaet Bochum, Institut fuer Energietechnik, 17. Jan 1996. Volltext nicht online.

  Griebel, P. (1997) Untersuchung zur schadstoffarmen Verbrennung bei atmosphaerischem Druck in einem fett-mager-gestuften Brennkammersektor fuer Flugtriebwerke. Vortrag am Paul Scherrer Institut (PSI), Villingen, Schweiz, 1997. Volltext nicht online.

  Griebel, P. (1997) Untersuchung zur schadstoffarmen Verbrennung bei atmosphaerischem Druck in einem fett-mager-gestuften Brennkammersektor fuer Flugtriebwerke. Vortrag bei der MTU Muenchen, 1997. Volltext nicht online.

  Griebel, P. (1997) Untersuchung zur schadstoffarmen, atmosphaerischen Verbrennung in einem Fett-Mager-Brennkammersektor fuer Flugtriebwerke. Dissertation. DLR-Forschungsbericht. 97-48, 120 S. Volltext nicht online.

  Griebel, P. und Behrendt, T. und Hassa, C. und Lueckerath, R. und Bergmann, V. und Stricker, W. und Zarzalis, N. (1995) Untersuchung eines atmosphärischen Fett-Mager-Brennkammersektors für Flugtriebwerke. 17. Deutscher Flammentag, 13.09.1995, Hamburg. Volltext nicht online.

  Griebel, P. und Behrendt, T. und Hassa, C. und Lueckerath, R. und Bergmann, V. und Stricker, W. und Zarzalisn, N. (1995) Investigation of an Atmospheric Rich-Quench-Lean Combustor Sector for Aeroengines. BRITE/EURAM Low NOx II Meeting, CFD Technical Review Task 4.1, 27.09.1995, Muenchen. Volltext nicht online.

  Griebel, P. und Bergmann, V. und Lueckerath, R. und Behrendt, T. und Hassa, C. (1995) RQL rectangular combustor CARS measurements and LDV measurements. Vortrag zum RQL Expert Group Meeting, Juni 1995, Poitiers, Frankreich. Volltext nicht online.

  Griebel, P. und Hassa, C. (1996) Subtask 1.2.5: LDV Measurement in the Rectangular Combustor Final Report. Projektbericht, DLR-Interner Bericht. Abschlußbericht BRITE EURAM Low NOx II, Subtask 1.2.5, Contract No. AERR-CT92-0036, 7 S. Volltext nicht online.

  Gugel, K.O. (1995) Experimentelle Untersuchung der Zwei-Phasen-Strömung in einem Vormischkanal. Vortrag am 16.02.1995 an der Universität Karlsruhe (TH), Engler-Bunte-Institut. Volltext nicht online.

  Görtz, Stefan und Ilic, Caslav und Jepsen, Jonas und Leitner, Martin und Schulze, Matthias und Schuster, Andreas und Scherer, Julian und Becker, Richard-Gregor und Zur, Sascha und Petsch, Michael (2017) Multi-Level MDO of a Long-Range Transport Aircraft Using a Distributed Analysis Framework. In: AIAA-2017-4326. 18th AIAA/ISSMO Multidisciplinary Analysis and Optimization Conference, 5.-9. Jun. 2017, Denver, USA. Volltext nicht online.

  Görtz, Stefan und Klimmek, Thomas und Zur, Sascha und Becker, Richard-Gregor und Kier, Thiemo und Kohlgrüber, Dieter und Schuster, Andreas und Jepsen, Jonas (2017) Overview and main challenges of MDO at DLR. 1st European Workshop on MDO for Industrial Applications in Aeronautics - Challenges and Expectations, 24.-25. Okt. 2017, Braunschweig, Germany. Volltext nicht online.

  Görtz, Stefan und Krumbein, Andreas und Ritter, Markus und Hofmann, Johannes (2018) DLR-Projekt VicToria - Virtual Aircraft Technology Integration Platform. Deutscher Luft- und Raumfahrtkongress 2018, 04.-06. Sep. 2018, Friedrichshafen. Volltext nicht online.


  Habisreuther, P. und Eickhoff, H. und Lenze, B. (1996) Experimental and Theoretical Investigations on the Formation of Thermal NOx in Confined Premixed and Nonpremixed Swirling Flames. 26th International Symposium on Combustion, Naples, Italy, 1996. Volltext nicht online.

  Habisreuther, P. und Eickhoff, H. und Lenze, B. (1997) Experimentelle und Numerische Untersuchungen an einer eingeschlossenen Erdgas-Drall-Diffusionsflamme. 18. Deutsch-Niederländischer-Flammentag, Delft, Sept. 1997. Volltext nicht online.

  Hage, W. und Bechert, D. und Bruse, M. (1997) Experiments with the drag reducing slip wall. Euromech 3rd European Fluid Mechanics Conference 1997, Göttingen, September 1997. Volltext nicht online.

  Hage, W. und Bechert, D.W. und Bruse, M. (1997) Experiments with the drag reducing slip wall. Euromech Colloquium 361, &quot;Active Control of Turbulent Shear Flows&quot; and Final Colloquium of DFG Research Group Control of Turbulent Flows, TU Berlin, März 1997. Volltext nicht online.

  Hage, W. und Bechert, D.W. und Bruse, M. (1997) Drag reduction from shark skin to the technical optimum. 2nd International Conference on Flow Interaction cum Exhibtion/ Lectures on Interaction of Science & Art (SCART), Berlin, Juli 1997. Volltext nicht online.

  Hage, W. (1) und Meyer, R. (1) und Bechert, D.W. (1997) Artificial bird feathers: An adaptive wing with high lift capability. 50th Annual Meeting, Division of Fluid Dynamics, American Physical Society, San Francisco, USA, 23.-25.11.97. Volltext nicht online.

  Hah, C. und Krain, H. (1989) Secondary Flows and Vortex Motion in a High-Efficiency Backswept Impeller at Design and Off-Design Conditions. The American Society of Mechanical Engineers, ASME Paper (89-GT-181), Seiten 1-10. Volltext nicht online.

  Hah, C. und Krain, H. (1999) Analysis of Transonic Flow Fields inside a High Pressure Ratio Centrifugal Compressor at Design and Off Design Conditions. ASME-Paper, June 1999, Indianapolis, USA (ASME-Paper 99-GT-446), Seiten 1-15. Volltext nicht online.

  Hah, C. und Krain, H. (1990) Secondary Flows and Vortex Motion in a High-Efficiency Backswept Impeller at Design and Off-Design Conditions. In: Transactions of the ASME, Journal of Turbomachinery, Vol. 112, (1990) No. 1., Vol. 112. ASME, New York. Volltext nicht online.

  Hampe, L. (1990) Konstruktiver Entwurf einer Brennkammer fuer einen Hyperschall-Schubduesen-Pruefstand. Diplomarbeit. Volltext nicht online.

  Hassa, C. (2001) Triebwerksbrennkammern im Zentrum für Verbrennungsforschung des DLR in Köln. In: DGLR Nachrichten. Bezirksgruppe Köln/Bonn, DGLR, Haus der Luft- und Raumfahrt, 11.04.2001. Volltext nicht online.

  Hassa, C. (2001) Pulsationen in Flugtriebwerken / Flüssige Brennstoffe. Fachveranstaltung Verbrennungsschwingungen H 030110891, Universität der Bundeswehr, Hamburg, 13.11.2001. Volltext nicht online.

  Hassa, C. (1990) Untersuchung von 2-Phasen-Stroemungen mit dem PDA. Lehrgang Laser-Doppler-Anemometer, Technische Akademie Esslingen 1990. Volltext nicht online.

  Hassa, C. (1991) Untersuchungen von 2-Phasenströmungen mit dem PDA. Lehrgang &quot;Laser-Doppler-Anemometer&quot; bei der Technischen Akademie Esslingen. Volltext nicht online.

  Hassa, C. (1994) Experimentelle Untersuchung der turbulenten Partikeldispersion in Drallströmungen. Dissertation. DLR-Forschungsbericht. 94-20, 153 S. Volltext nicht online.

  Hassa, C. (1995) Gestufte Verbrennung in Flugtriebwerken. Seminarreihe des ZARM, Fallturm Bremen, 23./24. Mai 1995. Volltext nicht online.

  Hassa, C. (1995) Forschungs- und Technologiearbeiten im Verbrennungslabor des Instituts für Antriebstechnik. Präsentation des Instituts für Antriebstechnik bei BMW-RR Aeroengines, Dahlewitz, 29.05.1995. Volltext nicht online.

  Hassa, C. (1995) Arbeiten zur Kraftstoffaufbereitung in Brennkammern am Institut für Antriebstechnik. Präsentation des Instituts für Antriebstechnik bei ABB, Baden, Schweiz, 24.03.1995. Volltext nicht online.

  Hassa, C. (1995) Kraftstoff-Aufbereitung in Brennräumen. Besuch der Gruppe Turbulenz in Brennräumen, AT-TF, BL, 06.02.1995, Köln-Porz. Volltext nicht online.

  Hassa, C. (1994) Instationary atomization and dispersion characteristics of a prefilming flatsheet airblast atomizer. DLR-Interner Bericht. 325-09-94, 36 S. Volltext nicht online.

  Hassa, C. (1994) Experimentelle Untersuchung der turbulenten Partikeldispersion in Drallstroemungen. Vortrag an der Fakultaet fuer Maschinenbau Bochum, Institut fuer Energieanlagentechnik, 12.04.1994. Volltext nicht online.

  Hassa, C. (1994) Characterization de l'atomization et de la dispersion instationnaire d'un atomiseur de géometrie bidimensionelle. Seminarvortrag am DERMES der CERT/ONERA, 25.02.1994, Toulouse, France. Volltext nicht online.

  Hassa, C. (1996) Brennstoffaufbereitung und Mischung. Engine 3E Partner-Status-Workshop, 11.-12.03.1996, Berlin-Dahlewitz, Vorhaben &quot;Technologische Grundlagen schadstoffarmer Verbrennung&quot;. Volltext nicht online.

  Hassa, C. (1996) Aktuelle Problemstellungen schadstoffarmer Luftfahrt-Gasturbinenbrennkammern. &quot;Clusterseminar&quot; Antriebe und Verbrennung, 9.12.96, Lampoldshausen. Volltext nicht online.

  Hassa, C. (1996) Experimentelle Untersuchungen in schadstoffarmen Modellbrennkammern. Vortrag an TU München 1996. Volltext nicht online.

  Hassa, C. (1997) Tests of First Advanced Cooling Mixing Concept. BRITE/EURAM &quot;Low Emissions Combustion Technology&quot; Low NOx II/Experts Meeting, Lissabon, 29.01.1997. Volltext nicht online.

  Hassa, C. (1996) Druckeinfluss auf die magere Stabilitaetsgrenze. Arbeitskreissitzung KEROMIX, Uni Karlsruhe, 21.10.1996. Volltext nicht online.

  Hassa, C. (1996) Gemischbildung in schadstoffarmen Brennkammern. Workshop Emissionen des Luftverkehrs und ihre Wirkung auf die Atmosphäre, 13.-14. Mai 1996, DLR-FZ Adlershof. Volltext nicht online.

  Hassa, C. und Arold, M. (1995) Investigation of Droplet Concentration Fluctuations in a Research Spray Combustion Chamber. In: Proc. 11th European Conference of ILASS Europe on Atmization and Sprays. Nürnberg 1995, 11, Seiten 23-32. Nürnberg Messe GmbH, ISBN-921590-34-5. Proceedings 11th European Conference of ILASS Europe on Atomization and Sprays, Nürnberg, 21.-23.03.1995. Volltext nicht online.

  Hassa, C. und Behrendt, T. und Frodermann, M. und Heinze, J. und Stursberg, K. (1999) Zerstäubung, Mischung und Flammen-Stabilität in hochbelasteten, schadstoffreduzierten Brennkammern für militärische Triebwerke. DLR-Interner Bericht. 325-04-99, 80 S. Volltext nicht online.

  Hassa, C. und Behrendt, T. und Griebel, P. (1996) LDA-Messungen in einem atmosphaerischen Fett-Mager-Brennkammersektor fuer Flugtriebwerke. In: Lasermethoden in der Strömungsmeßtechnik, 5. Fachtagung, 11.-13.09.1996, Berlin. Shaker, Aachen. Lasermethoden in der Stroemungsmesstechnik, 5. Fachtagung, 11.-13.09. 1996, Berlin der Deutschen Gesellsch. f. Laser-Anemometrie. Volltext nicht online.

  Hassa, C. und Behrendt, T. und Heinze, J. (2003) Experimentelle Untersuchung eines Vormischbrennerkonzepts für die magere Vormischverbrennung mit Vorverdampfung in Gasturbinen. In: 21. Deutscher Flammentag, 1750, Seiten 289-296. VDI Verlag, Düsseldorf. 21. Deutscher Flammentag, Cottbus, 9-10. 9. 2003. ISBN 3-18-091750-4 Volltext nicht online.

  Hassa, C. und Biscos, Y. und Lavergne, G. (1994) Instationary Atomization and Dispersion Characteristics of a prefilming flatsheet airblast atomizer. Begell House, NY, USA. Poster '95, Proceedings at the 6th. Int. Conference on Liquid Atomization and Spray Systems, New York, USA, 18.-22.07.94. Volltext nicht online.

  Hassa, C. und Bluemcke, E. und Brandt, M. und Deick, A. und Arold, M. (1995) Untersuchungen zur turbulenten Partikeldispersion an einer Luftstrom-Zerstäuberdüse. Seminarvortrag am Hermann-Föttinger-Institut, Technische Universität Berlin, 28.04.1995. Volltext nicht online.

  Hassa, C. und Bluemcke, E. und Brandt, M. und Eickhoff, H. (1991) Die Struktur eines Sprays in verdrallter Strömung. 7. Tecflam-Seminar, DLR-Stuttgart, 14.11.1991. Volltext nicht online.

  Hassa, C. und Blümcke, E. und Eickhoff, H. (1990) Measurements of Eulerian Macro Timescales in Highly Swirling Flows a nd Comparison with a Computational Model. In: Proceedings.. 5th Int. Symposium on Application of Laser Techniques to Fluid Mechanics, 9-12 July 1990, Lisbon, Portugal.. Volltext nicht online.

  Hassa, C. und Blümcke, E. und Eickhoff, H. (1990) The Application of Phase-Doppler-Anemometry to an Airblast Atomizer-Burner-Configuration. Nato Advanced Study Institute on Combusting Flow Diagnostics, Montech oro 1990. Volltext nicht online.

  Hassa, C. und Brandt, M. (1997) Investigation of Cross-stream injection in High Pressure Duct. Minutes of Expert Meeting &quot;Focused Generic Combustion&quot;, BRITE/EURAM Low Emission Combustion III, IST Lissabon, 30.01.1997. Volltext nicht online.

  Hassa, C. und Graben, M. und Heinze, J. und Stursberg, K. (2001) Untersuchung der Antwort einer Luftstromzerstäuberversuchsbrennkammer-Konfiguration der Luftzufuhr bei realistischen Betriebsbedingungen. Deutscher Luft- und Raumfahrtkongress 2001, Hamburg, 17-20 Sept. 2001. Volltext nicht online.

  Hassa, C. und Griebel, P. und Behrendt, T. (1995) LDV & Cars measurements in rectangular combustor. RQL Expert Group Meeting, Karlsruhe, 07.12.1994, Brite Euram/Low Emission Combustor Technology Program. Volltext nicht online.

  Hassa, C. und Heinze, J. und Stursberg, K. (2001) Response of a research combustor on forced oscillations at realistic operating conditions. LECT Workshop on Instabilities, DLR Stuttgart, 4.12.2001. Volltext nicht online.

  Hassa, C. und Heinze, J. und Stursberg, K. (2002) Investigation of the response of an air blast atomiser combustion chamber configuration on forced modulation of air feed at realistic operating conditions. Proceedings ASME TURBO EXPO 2002, The 47th ASME International Gas Turbine & Aeroengine Technical Congress, paper GT-2002-30059, Amsterdam, june 3-6, 2002.. Volltext nicht online.

  Hassa, C. und Heinze, J. und Stursberg, K. (2003) Investigation of the Response of an Air Blast Atomizer Combustion Chamber Configuration on Forced Modulation of Air Feed at Realistic Operation Conditions. Transactions of the ASME - A - Engineering for Gas Turbines and Power, 125, Seiten 862-878. Volltext nicht online.

  Hassa, C. und Hungenberg, H.G. und Schodl, R. (1999) Das DLR-Zentrum für Verbrennungsforschung. DLR-Nachrichten (92), Seiten 20-21. Volltext nicht online.

  Hassa, C. und Migueis, C.E. und Voigt, P. (1998) Design Principals for the Quench Zone of Rich-Quench-Lean Combustors. In: Design Principles and Methods for Aircraft Gas Turbine Engines, 18-1-18-11. Canada Communication Group Inc.. RTO-Symposium, Toulouse, Frankreich, 12.05.1998. ISBN 92-837-0005-8 Volltext nicht online.

  Hassa, C. und Rachner, M. (1996) Messung der Zweiphasenstroemung (Tropfengeschwindigkeit und -groesse)in einer Oelmischvorstrecke. Vortrag bei der TURBOFLAM Arbeitskreissitzung, TU Dresden, 18.10.96. Volltext nicht online.

  Hassa, C. und Schodl, R. und Hungenberg, H.-G. und Becker, J. und Behrendt, Th. und Carl, M. und Heinze, J. und Stursberg, K. (2002) Experimental Investigations for the Verification of Gas Turbine Combuster CFD at the DLR Institute of Propulsion Technology. Poster Presentation at SFB 568 Workshop, Darmstadt, 14/15 Nov., 2002.. Volltext nicht online.

  Hassa, C. und Voigt, P. und Lehmann, B. und Schodl, R: und Carl, M. und Ripplinger, T: und Zarzalis, M. (2002) Flow field mixing characteristics of an aero-engine combustor - Part 1: Experimental results. 38th IAA/ASME/SAE/ASEE Joint Propulsion Conference and Exhibit, Indianapolis (US), 7-10 July, 2002. Volltext nicht online.

  Hassa, C. und Voigt, P. und Schodl, R. und Carl, M. und Ripplinger, T. und Zarzalis, N. und Lehmann, B. (2002) Flow-field mixing characteristics of an aero-engine combustor - Part 1: Experimental results. In: Proceedings of 38th AIAA/ASME/SAE/ASEE Joint Propulsion & Exhibit. 38th AIAA/ASME/SAE/ASEE Joint Propulsion Conference & Exhibit, 7.-10. July 2002,. Volltext nicht online.

  Hassa, C. und Winandy, A. und Brandt, M. (1991) Messen mit dem Laser - damit Kraftstoff besser verbrennt. DLR-Nachrichten, 63, Seiten 49-52. Volltext nicht online.

  Hassa, Ch. und Hungenberg, H. G. und Schodl, R. (2002) Test rigs and instrumentation - New capabilities of DLR's combustion test center in Cologne. 4th ONERA-DLR Aerospace Symposium, Cologne (Ger) 13/14 June 2002. Volltext nicht online.

  Hausmann, J. und Kocian, F. und Nicke, E. (2004) Realisation of a new compressor concept by usage of metal and polymer matrix compositeas for aeroengines. In: Materials & Process Technology -the Driver for Tomorrow's Improved Performance (Proceedings of the 25th International SAMPE Europe conference of the Society for the Advancement of Materials and Process Engineering, Paris 2004), 1, Seiten 159-164. CLA Ltd, London. 25th International SAMPE Europe conference of the Society for the Advancement of Materials and Process Engineering, Paris EXPO, Porte de Versailles, Paris, Frankreich, 30.03-01.04.2004. ISBN 3-9522677-1-6 Volltext nicht online.

  Heesen, W. (1) und Lindener, N. (2) und Neise, W. (1996) Elimination of a high-frequency narrow-band noise component in a low-noise automobile wind tunnel. In: Vehicle Aerodynamics: Wind tunnels, CFD, Aeroacoustics, and ground transportation systems. SP-1145 (1996) 197-206. SAE Conference, Feb. 26-29, 1996, Detroit, USA. Volltext nicht online.

  Hein, O. (1990) Waermeuebergang, Kuehlkanal. 3. Arbeitskreissitzung AG-Turbo, 16. Maerz 1990, Muelheim an der Ruhr.. Volltext nicht online.

  Heinrich, Jörg (2011) Strukturmechanik Gesamttool für das Projekt EVITA. DLR-Interner Bericht. [DLR-IB 435-2011/13], 135 S. (nicht veröffentlicht) Volltext nicht online.

  Heinrich, Jörg und Schmidt, Thomas (2011) Strukturmechanik-Tools im Projekt EVITA: Schnelle Abschätzung strukturmechanischer Eigenschaften der Verdichter- und Turbinenbauteile Schaufelblatt, Rotordisk und Containment eines Turbo-Strahltriebwerks. DLR-Interner Bericht, Projektbericht. [DLR-IB 435-2011/08], 32 S. (nicht veröffentlicht) Volltext nicht online.

  Heinze, J. und Fischer, M. und Röhle, I. und Schodl, R. (2000) DGV-Messungen in Flammen. In: Lasermethoden in der Strömungsmesstechnik. Shaker Verlag, Aachen (Deutschland), 2000. Lasermethoden in der Strömungsmesstechnik, 8. Fachtagung, GALA 2000. ISBN 3-8365-7809-0 Volltext nicht online.

  Heinze, Johannes und Diers, Olaf und Magens, Eggert und Meier, Ulrich (2009) Phase-resolved 2D diagnostics of self-excited combustion oscillations in a gas turbine model combustor. Gordon Research Conference - Laser Diagnostics in Combustion, 16.-21. Aug. 2009, Waterville Valley, NH (USA). Volltext nicht frei. filefile

  Helming, K. (1994) Experimental and Numerical Investigation of a Shock Wave within a Swept Shrouded Propfan Rotor. ASME. ASME Tagung, 1994. Volltext nicht online.

  Helming, K. (1996) Numerical Analysis of Sweep Effects in Shrouded Propfan Rotors. Journal of Propulsion and Power, Vol. 12, Nr. 1, S. 139-145, Jan./Feb. 1996. American Inst. of Aeronautics and Astronautics, INC, Washington, USA. Volltext nicht online.

  Heltsch, N. (2000) Experimentelle Untersuchung eines Fett-Mager-Brennkammersektors als Pilotstufe einer brennstoffgestuften Flugtriebwerksbrennkammer. Diplomarbeit. DLR-Interner Bericht. 325-02-2000, 84 S. Volltext nicht online.

  Hemmer, Harry und Schaefer, Martin und Otten, Tom (2008) Einfluss lärmarmer An- und Abflugverfahren auf NO<sub>X</sub>- und CO<sub>2</sub>-Emissionen im Flughafennahbereich. In: DGLR Jahrbuch 2008. Deutscher Luft- und Raumfahrtkongress 2008, 2008-09-23 - 2008-09-25, Darmstadt. Volltext nicht online.

  Hendricks, J. und Kärcher, B. und Döpelheuer, A. und Feichter, J. und Lohmann, U. (2004) Potential Impact of Aviation-Induced Black Carbon on Cirrus Clouds: Global Model Studies with the ECHAM GCM. Projektbericht. 83, 249 S. Volltext nicht online.

  Hendricks, Johannes und Kärcher, Bernd und Döpelheuer, Andreas und Feichter, Johann und Lohmann, Ulrike (2003) Global model studies on the contribution of air traffic to the black carbon budget of the tropopause region. EGS, General Assembly, 2003-04-06 - 2003-04-11, Nice (France). Volltext nicht online.

  Hendricks, Johannes und Kärcher, Bernd und Döpelheuer, Andreas und Feichter, Johann und Lohmann, Ulrike (2003) Global model studies on the contribution of air traffic to the black carbon budget of the tropopause region. In: Journal of Aerosol Science, Seiten 1051-1052. European Aerosol Conference 2003, 2003-08-31 - 2003-09-05, Madrid, Spain. ISSN 0021-8502 Volltext nicht online.

  Henning, Arne und Plohr, Martin und Özdemir, Doruk und Hepting, Michael und Keimel, Hermann und Sanok, S. und Sausen, Robert und Pregger, Thomas und Seum, Stefan und Heinrichs, Matthias und Müller, Stephan und Winkler, Christian und Neumann, Thorsten und Seebach, Oliver und Matthias, Volker und Vogel, Bernhard (2016) The DLR Transport and the Environment Project - Building competency for a sustainable mobility future. DLR-Forschungsbericht. DLR-FB-2015-38, 192 S. file

  Herr, Milena (2017) Implementierung eines Verfahrens zur automatisierten Kennfeldberechnung auf Basis eines Verdichter Meanline-Codes. Bachelorarbeit, Institut für Antriebstechnik. file

  Herrmann, M. und Neise, W. (1995) Experimental Investigation of Noise Sources in Cross-flow Fans. Contract Report to United Technologies Research Center. Carrier Corp., Syracuse, N. Y., 20 November 1995. Volltext nicht online.

  Herrmann, M. und Neise, W. (1995) Experimental Investigation of Noise Sources in Cross-Flow Fans. DLR-Interner Bericht. 92517-95/B8, 204 S. Volltext nicht online.

  Herrmann, M. und Neise, W. (1997) Experimental investigation of noise sources in cross-flow fans with different vortex wall shapes. Contract Report to United Technologies Research Center. DLR-Interner Bericht. 92517-97/B6, 188 S. Volltext nicht online.

  Herrmann, M. und Neise, W. und Enghardt, L. und März, J. (1997) Three-hole probe measurements in cross-flow fan and data summary for technology transfer. Contract Report to United Technologies Research Center. DLR-Interner Bericht. 92517-97/B9, 86 S. Volltext nicht online.

  Heselhaus, A. (1993) Dreidimensionale Effekte der realen stationaeren Stroemung auf den Waermeuebergang an Turbinenschaufeln. Projektbericht, DLR-Interner Bericht. Abschlußbericht zum BMFT-Vorhaben 0326500A, AG Turbo, Turbotherm Bauteilkühlung, Vorhaben, 54 S. Volltext nicht online.

  Heselhaus, A. (1995) Gekoppelte Berechnung der Temperaturverteilung in diabat umströmten Körpern. Bauteilen von Gasturbinen&quot;, 27.-28. Juli 1995, Berlin. Volltext nicht online.

  Heselhaus, A. (1996) Gekoppelte Berechnung der Materialtemperaturen in gekuehlten Turbinenschaufeln. Kolloquium Energietechnik, Ruhr-Universitaet Bochum, 1996. Volltext nicht online.

  Heselhaus, A. (1996) Gekoppelte Berechnung des äußeren Wärmeübergangs und der Materialtemperaturen konvektionsgekühlter Turbinenschaufeln. In: Tagungsband zum 5. Statusseminar der AG-Turbo. 5. Statusseminar der AG-Turbo, 5-6. Dez. 1996, Sekretariat der AG-Turbo, DLR Köln-Porz. Volltext nicht online.

  Heselhaus, A. (1997) Ein hybrides Verfahren zur gekoppelten Berechnung von Heißgasströmung und Materialtemperaturen am Beispiel gekühlter Turbinenschaufeln. Dissertation. DLR-Forschungsbericht. 97-10, 143 S. Volltext nicht online.

  Heselhaus, A. (1998) A Hybrid Coupling Scheme and Stability Analysis for Coupled Solid/ Fluid Turbine Blade Temperature Calculations. In: ASME Turbo-Expo 98. ASME Turbo-Expo 98, 2.-5. Juni 1998, Stockholm. Volltext nicht online.

  Heselhaus, A. (1997) Gekoppelte Berechnung des äußeren Wärmeübergangs und der Materialtemperaturen konvektionsgekühlter Turbinenschaufeln. Projektbericht, DLR-Interner Bericht. Volltext nicht online.

  Heselhaus, A. und Vogel, D.T. (1995) Numerical Simulation of Turbine Blade Cooling with Respect to Blade Heat Conduction and Inlet Temperature Profiles. c by American Inst. of Aeronautics and Astronautics, Washington D.C.. AIAA paper 95-3041, San Diego, CA, USA. Volltext nicht online.

  Heselhaus, A. und Vogel, T. und Krain, H. (1992) Coupling of 3D-Navier-Stokes External Flow Calculations and Internal 3D-Heat-Conduction Calculations for Cooled Turbine Blades. In: AGARD-CP AGARD Conference Proceedings, Heat Transfer and Cooling in Gas Turbines. AGARD. ISBN 1. Volltext nicht online.

  Hoeren, A. (1996) Experimentelle Untersuchung der Auswirkung von Turbulenzerzeugern auf die Kraftstoffdispersion und -verdampfung in einem Vormischkanal. sonstiger Bericht. RUB, Bochum, Fakultät f. Maschinenbau, Lehrstuhl f. Fluidenergiemaschinen. Volltext nicht online.

  Hoffmann, B. (1990) Zur Berechnung raeumlicher, reibungsbehafteter Stroemungen in Turbomaschinen. ABB, 15. November 1990, Baden, Schweiz. Volltext nicht online.

  Hoffmann, B. und Nürnberger, D. und Weber, A. und Hong Yang, (2003) Strömungssimulation eines Radialverdichter-Laufrades zur Untersuchung des Pumpgrenzbereichs. Projektbericht, DLR-Interner Bericht. 02-03, 77 S. Volltext nicht online.

  Hoffmann, B. und Weber, A. und Hong Y., (2004) Strömungssimulation eines Radialverdichter-Laufrades mit Variation der Schaufelhinterkante. DLR-Interner Bericht. 325-11-04, 30 S. Volltext nicht online.

  Hoffmann, Bettina und Krain, Hartmut (2007) Kompaktdiffusor, Stand der theoretischen und experimentellen Arbeiten. [sonstige Veröffentlichung] Volltext nicht online.

  Hoffmann, S. und Habisreuther, P. und Lenze, B. und Eickhoff, H. (1995) Lean stability limits of turbulent swirling natural gasflames. In: Proc. Int. Gas Research Conf. 1995, Cannes. International Gas Research Conference, Cannes, France. Volltext nicht online.

  Hoffmann, S. und Lenze, B. und Eickhoff, H. (1997) Results of Experiments and Models for Predicting Stability Limits of Turbulent Swirling Flames. ASME. Volltext nicht online.

  Hoffmann, S. und Philipp, M. und Lenze, B. und Eickhoff, H. (1991) Experimentelle und numerische Untersuchungen zum Stabilitätsverhalten freibrennender Vormischflammen. In: VDI-Berichte, Seiten 463-472. 15. Deutscher Flammentag. Volltext nicht online.

  Hoffmann, W. (1990) Programmsystem zur numerischen Behandlung stationärer räumlicher Strömungen in Turbomaschinenkomponenten. Dissertation. DLR-Forschungsbericht. 90-18, 157 S. Volltext nicht online.

  Holste, F. (1995) Ermittlung der aerodynamischen Lärmquellen und Berechnung des abgestrahlten Schallfeldes mittels der im Nahfeld gemessenen Druckschwankungen am Beispiel eines Triebwerksmodells. Dissertation, Technische Universität Berlin, Dissertation. Volltext nicht online.

  Holste, F. (1995) An Equivalent Source Method for Calculation of the Sound Radiated from Aircraft Engines. In: Proc. First CEAS/AIAA Aeroacoustics Conference. DGLR-Bericht 95-01 (1995) 729-738, 17 Bild., 1 Tab., 12 Lit.. First CEAS/AIAA Aeroacoustics Conference (16th AIAA Aeroacoust. Conference), Munich, 12-15 June 1995;. Volltext nicht online.

  Holste, F. und Neise, W. (1995) Akustische Nahfeldmessungen an einem Triebwerksmodell zur Ermittlung der dominierenden Schallerzeugungsprozesse. In: Fortschritte der Akustik - DAGA '95 (1995), Seiten 403-406. DPG GmbH, Bad Honnef 1995. DAGA '95, Saarbrücken, 14.-17.03.1995. Volltext nicht online.

  Holste, F. und Neise, W. (1995) Acoustical Near Field Measurements on a Propfan Model for Noise Source Identification. In: Proc. First CEAS/AIAA Aeroacoustics Conference . DGLR-Bericht 95-01 (1995) 1221-1229, 6 Bild., 2 Tab., 5 Lit.. First CEAS/AIAA Aeroacoustics Conference (16th AIAA Aeroacoustics Conference), Munich, 12-15 June 1995. Volltext nicht online.

  Holste, F. und Zhang Y., und Neise, W. (1996) Experimental analysis of acoustical modes generated by the interaction of two non-synchronous rotors. In: Proc. 2nd AIAA/CEAS Aeroacoustics Conference (1996). 2nd AIAA/CEAS Aeroacoustics Conference (17th AIAA Aeroacoustics Conf.), May 6-8, 1996, Penn State University, State College, Penns., USA. Volltext nicht online.

  Holste, F. (1) (1997) An equivalent source method for calculation of the sound radiated from aircraft engines. Journal of Sound and Vibration 203 (1997) 667-695. Volltext nicht online.

  Holste, F. (1) und Neise, W. (1997) Noise source identification in a propfan model by means of acoustical near field measurements. Journal of Sound and Vibration 203 (1997) 641-655. Volltext nicht online.

  Holzknecht, G. (1999) Numerische Simulation des Verhaltens wärmegetauschter Triebwerke für zivile Luftfahrtantriebe. Diplomarbeit. DLR-Interner Bericht. 325-05-99. Volltext nicht online.

  Hong Yang, (2003) Unsteady Flow Simulation of a Transonic Compressor Coupled with Casing Treatment. In: Proceedings of 11th Annual Conference of CFD Society of Canada. 11th Annual Conference of CFD Society of Canada (CFD2003), Vancouver, B.C., May 28-30, 2003. Volltext nicht online.

  Hong Yang, und Dirk Nuernberger, und Eberhard Nicke, und Anton Weber, (2003) Numerical Investigation of Casing Treatment Mechanisms with Conservative Mixed-Cell Approach. In: Proceedings of ASME Turbo Expo 2003, Power for Land, Sea, and Air. ASME Turbo Expo 2003, ASME Paper GT2003-38483, Atlana, USA, June 16-19, 2003. Volltext nicht online.

  Huber, Kerstin Claudie und Loeser, Thomas und Looye, Gertjan und Liersch, Carsten M. und Lindermeir, Erwin und Kemptner, Erich und Klimmek, Thomas und Koch, Stefan und Kuchar, Richard und Nauroz, Mobin und Paul, Michael und Rein, Martin und Rode, Gerald und Rohlf, Detlef und Rütten, Markus und Schütte, Andreas und Schwithal, Jana und Siggel, Martin und Voss, Arne und Zimper, Dirk (2015) Bewertung und Entwurf von agilen und hoch gepfeilten Flugzeugkonfigurationen. DLR-Interner Bericht. DLR-IB 124-2015/913, 120 S. Volltext nicht online.

  Huebner, K. (1992) Laseroptische simultane L2F-Partikelgrößen- und Geschwindigkeitsmessung. DLR-SM-AT-Seminar, July 1992. Volltext nicht online.

  Hummel, F. (2001) Zeitabhängiger Einfluss einer transsonischen Hochdruckturbine auf ein nachfolgendes Leitgitter. Dissertation. DLR-Forschungsbericht. 2001-13, 144 S. Volltext nicht online.

  Hummel, F. (2001) Wake-Wake Interactions and ITS Potential for Clocking in a Transonic High Pressure Turbine. In: The 46th ASME International Gas Turbine & Aeroengine Technical Congress, ASME TURBO EXPO 2001. ASME TURBO EXPO, New Orleans, 04-07. Juni 2001, New Orleans. Volltext nicht online.

  Hungenberg, H. und Stursberg, K. (1996) Erhoehung der Lufterhitzerkapazitaet fuer Untersuchungen an schadstoffarmen Brennkammern. DLR-Interner Bericht. 325-03-96, 9 S. Volltext nicht online.

  Hungenberg, H. und Stursberg, K. und Weyer, H. (1991) Thrust Nozzle Test Facility at DLR Cologne. In: AIAA-91-5024. American Inst. of Aeron. and Astron. Washington, USA. Volltext nicht online.

  Hungenberg, H.-G. (1998) Ausbau des Zentrums für Verbrennungsforschung, techn. Phase II. DLR-Interner Bericht. 325-10-98. Volltext nicht online.

  Hungenberg, H.-G. (2000) Ausbau der Infrastruktur des Zentrums für Verbrennungsforschung. DLR-Interner Bericht. 325-01-2000, 15 S. Volltext nicht online.

  Hungenberg, H.G. und Schimming, P. (1991) Modifizierung des M2VP zur Untersuchung des Hochtemperaturfans eines Hyperschallantriebes BMFT-Förderkonzept Hyperschalltechnologie, Förderkennzeichen HI8901I7. Projektbericht, DLR-Interner Bericht. 325-07-91. Volltext nicht online.

  Hungenberg, H.G. und Stursberg, K. (1997) Ausbau des DLR-Verbrennungszentrums DLR-Vorhaben zum Leitkonzept Umweltschonender Antrieb &quot;Engine 3E 2010&quot;. DLR-Interner Bericht. 325-02-97, 18 S. Volltext nicht online.


  Iwanizki, Michael und Strack, Matthias und Zimmer, Dirk und Plohr, Martin (2018) Conceptual Design and Preliminary Analysis of Short Range Aircraft Concepts with Hybrid Electric Propulsion. 18. ONERA-DLR Aerospace Symposium (18. ODAS), 03.-05. Mai 2018, Bonn, Deutschland. (nicht veröffentlicht) Volltext nicht online.


  Janicka, J. und Eickhoff, H. und Bauer, W. (1996) Das Cray-Tecflam-Projekt Entwicklung einer modernen, kommerziellen Software fuer technische Verbrennungsprozesse. 12. Tecflam-Seminar, Darmstadt 1996. Volltext nicht online.

  Jarius, M. (2003) &quot;Particle Image Velocimetry&quot; im rotierenden Kühlkanal. Kolloquium zu Ehren von Prof.Dr.-Ing.G.Winterfeld,Köln,15.Okt.2003. Volltext nicht online.

  Jarius, M. und Elfert, M. (2002) Steady Fluid Flow investigation using PIV in a multi-pass coolant channel. 11th International Symposium on Applications of Laser Techniques to Fluid Mechanics, Lisbon, 8-11 June, 2002.. Volltext nicht online.

  Jarius, M.P. und Elfert, M. (2004) Application von PIV und Stereo-PIV an einem Kühlsystem einer Turbinenrotorschaufel mit verrippten Wänden. In: 12.Fachtagung. 12.GALA-Facht. Lasermethoden in der Strömungsmesstechnik,7.-9.Sept. 2004,Karlsruhe. Volltext nicht online.

  Jarius, M.P. und Elfert, M. (2004) Detailed fflow investigation using PIV in a stationary two-pass cooling geometry. In: Proceedings. 12th Intern.Symp. on Aplications of Laser Techniques to Fluid Mechanics,12-15.July,2004,Lisbon,Portugal. Volltext nicht online.

  Jarius, P.M. und Elfert, M. (2003) Flow investigation in a two-pass coolant channel with/ without ribbed walls. In: Proceedings. 16th Int.Symp.on Air Breathing Engines,Aug.31-Sept.5,2003 Cleveland,Ohio,USA. Volltext nicht online.

  Jawtusch, V. (1990) Verlustberechnungen fuer das Verdichtergitter MAN GHH 1-S1. Vergleich zwischen Messung und Rechnung. DLR-Interner Bericht. 325-01-90, 51 S. Volltext nicht online.

  Jawtusch, V. (1993) Verbesserte Verlustberechnungen fuer die superkritischen Verdichtergitter SKG-FVV 3.3 und SKG-FVV 4.1; Vergleich zwischen Messung und Rechnung. DLR-Interner Bericht. 325-07-93, 73 S. Volltext nicht online.

  Jawtusch, Vera (1994) Verlustberechnungen fuer die Verdichtergitter GHH-RAS92 und GHH-LNS92. Vergleich mit Messergebnissen. DLR-Interner Bericht. 325-01-94, 86 S. Volltext nicht online.

  Jentink, H.W. und Beversdorff, M. und Foerster, W. (1995) Laser Anemometry for In-Flight Flow Investigations. 16th ICIASF 1995 (International Congress on Instrumentation in Aerospace Simulation Facilities), July 18-21, 1995, Dayton, Ohio, USA. Volltext nicht online.

  Josuhn-Kadner, B. und Hoffmann, B. (1993) Investigations on a Radial Compressor Tandem Rotor Stage with Adjustable Geometry. Journal of Turbomachinery, Transactions of the ASME 115 (1993) 3, 115, Seiten 552-559. ASME, New York, USA. Volltext nicht online.

  Junge, Laura und Kersken, Hans-Peter und Frey, Christian und Ashcroft, Graham (2018) On the Development of Harmonic Balance Methods for Multiple Fundamental Frequencies. In: Proceedings of the ASME Turbo Expo. ASME Turbo Expo 2018, 11.-15. Jun. 2018, Oslo, Norwegen. Volltext nicht online.

  Junker, Martin (2017) Numerische Untersuchung des Betriebsverhaltens eines Radialverdichters bei nicht idealer Anströmung. Bachelorarbeit, FH Aachen University of Applied Sciences. Volltext nicht online.

  Jöcker, M. und Freudenreich, K. und Fransson, T.H. und Rehder, H.-J. (2000) Parametric studies of the aerodynamic excitation in high pressure turbines. 9th International Symposium on Unsteady Aerodynamics, Aeroacoustics and Aeroelasticity of Turbomachines (ISUAAAT), Lyon/France, 4.-8. September 2000, Frankreich. Volltext nicht online.

  Jöcker, M. und Kessar, A. und Fransson, T. und Kahl, G. und Rehder, H.-J. (2003) Comparison of Models to Predict Low Engine Order Excitation in a High Pressure Turbine Stage. 10th International Symposium on Unsteady Aerodynamics, Aeroacoustics and Aeroelasticity in Turbomachines, Durham NC, USA, Sept. 7-11 2003, Durham, NC USA. Volltext nicht online.


  Kaeufer, B. (1997) Entwurf und Konstruktion eines Luftstromzerstaeubers und dessen Integration in eine Vorverdampferduese. DLR-Interner Bericht. 325-08-97, 99 S. Volltext nicht online.

  Kallergis, K. (1993) Experimentelle Untersuchungen der Sprayeigenshcaften verschiedener Zerstaeuberduesen und -konfigurationen unter erhoehtem Druck. Diplomarbeit. Volltext nicht online.

  Kallergis, K.M. (1996) Zur Problematik der Halon-Ersatzstoffe in der Luftfahrt. 5. Workshop NBL, Oberhof, 30.-31. Jan. 1996. Volltext nicht online.

  Kallergis, K.M. (1995) Testing of Halon-Replacements on Aircraft Interior Fires. International Halon Replacement Working Group Meeting, Atlantic City, USA, November 17, 1995. Volltext nicht online.

  Kallergis, K.M. (1995) Definition von Anforderungen an Halon-Ersatzstoffe zur Brandbekämpfung in Flugzeugen. Projektbericht, DLR-Interner Bericht. Volltext nicht online.

  Kallergis, K.M. (1995) DLR Halon Replacement-Trials, State of the Art. International Halon Replacement Working Group Meeting, Rome, Italy, April 19-20, 1995. Volltext nicht online.

  Kallergis, K.M. (1996) Extinguishing of Aircraft Interior Fires with Halon Replacements for Handheld Extinguishers. AGARD-Symp. &quot;Aircraft Fire Safety&quot;, Okt. 1996, Dresden. Volltext nicht online.

  Kallergis, K.M. (1997) Definition von Anforderungen an Halon-Ersatzstoffe zur Brandbekaempfung in Flugzeugen. Projektbericht, DLR-Interner Bericht. Volltext nicht online.

  Kallweit, Stephan und Dues, Michael und Müller, Ulli und Lederer, Thomas und Schroll, Michael und Willert, Christian (2007) Einsatz der Particle Image Velocimetry zur Untersuchung von Rohrströmungen. In: Lasermethoden in der Strömungsmesstechnik, 15. Fachtagung der GALA, 35.1-35.8. Lasermethoden in der Strömungsmesstechnik, 15. Fachtagung der GALA, 2007-09-04 - 2007-09-06, Rostock. ISBN ISBN 978-3-86009-007-7 Volltext nicht frei. file

  Kallweit, Stephan und Willert, Christian und Dues, Michael und Müller, Ulrich und Lederer, Thomas (2008) PIV for volume flow metering. 14th International Symposium on Applications of Laser Techniques to Fluid Mechanics, 2008-07-07 - 2008-07-10, Lisbon (Portugal). file

  Kameier, F. und Neise, W. (1995) Experimental Study of Tip Clearance Losses and Noise in Axial Turbomachines. VDI-Tagung Turbomachinery - Fluid Dynamic and Thermodynamic Aspects, 1-3 March 1995, Dahlewitz. Volltext nicht online.

  Kameier, F. und Neise, W. (1995) Reduction of Tip Clearance Loss and Tip Clearance Noise in Axial Flow Machines. In: Proc. AGARD PEP 85th Meeting on Loss Mechanisms and Unsteady Flows in Turbomachines 1995. AGARD PEP 85th Meeting on Loss Mechanisms and Unsteady Flows in Turbomachines, Derby, UK, 8-12 May 1995. Volltext nicht online.

  Kameier, F. und Neise, W. (1995) Rotating Blade Flow Instability as a Source of Noise in Axial Turbomachines. In: Proc. First CEAS/AIAA Aeroacoustics Conference. DGLR-Bericht 95-01, Seiten 157-166. First CEAS/AIAA Aeroacoustics Conference (16th AIAA Aeroacoust. Conference, Munich, 12-15 June 1995. Volltext nicht online.

  Kameier, F. und Neise, W. (1997) Experimental study of tip clearance losses and noise in axial turbomachinery and their reduction. Journal of Turbomachinery 119 (1997) 460-471. Volltext nicht online.

  Kameier, F. (1) und Neise, W. (1997) Rotating blade flow instability as a source of noise in axial turbomachines. Journal of Sound and Vibration 203 (1997) 833-853. Volltext nicht online.

  Kameier, F. (1) und Neise, W. und Schuch, A. (2) (1996) Einfluss der Schaufelzahl und der Kopfspaltweite auf den Spitzenwirbellaerm axialer Stroemungsmaschinen. In: VDI-Bericht 1249 (1996) 75-79. VDI-GET-Tagung &quot;Ventilatoren im industriellen Einsatz III&quot;, Braunschweig, 28.-29.2.1996. Volltext nicht online.

  Karpinski, G. (2000) Drei-Komponenten-Doppler-Laser-zwei-Fokus-Geschwindigkeitsmeßsystem für berührungslose Messung der Strömungsgeschwindigkeit an besonders schwer zugänglichen Stellen. Dissertation. DLR-Forschungsbericht. 2000-25, 117 S. Volltext nicht online.

  Keppel, W. und Weyer, H.B. (1995) Präsentation TURBOFLAM. Außerordentliche Sitzung des VGB-Fachausschusses &quot;Vergasungsanlagen&quot; VGB-Haus, VGB-Essen, 24.08.1995. Volltext nicht online.

  Kersken, Hans-Peter und Schreiber, Andreas und Strietzel, Martin und Faden, Michael und Ahrem, Regine und Post, Peter und Wolf, Klaus und Beckert, Armin und Gerholt, Thomas und Heinrich, Ralf und Kügeler, Edmund (2000) AMANDA - A Distributed System for Aircraft Design. In: Euro-Par 2000 - Parallel Processing: 6th International Euro-Par Conference, 1900, Seiten 1315-1322. Springer-Verlag. Euro-Par 2000, 2000-08-29 - 2000-09-01, München, Deutschland. Volltext nicht online.

  Kersken, Hans-Peter und Ashcroft, Graham und Frey, Christian und Pütz, Oliver und Stüer, Heinrich und Schmitt, Stefan (2012) Validation of a Linearized Navier-Stokes Based Flutter Prediction Tool Part1: Numerical Methods. ASME Turbo Expo 2012, 11.-15. Juni 2012, Kopenhagen, Dänemark. Volltext nicht online.

  Kessar, A. und Joecker, M. und Fransson, T. und Rehder, H.-J. und Kost, F. (2005) Flow Measurements for Low Engine Order Excitations in a High Pressure Turbine Stage. 6th European Conference on Turbomachinery - Fluid Dynamics and Thermodynamics , Lille France, March 15, 2005, Frankreich. Volltext nicht online.

  King, W. F. III (1996) A précis of developments in the aeroacoustics of fast trains. Journal of Sound and Vibration, 193, Seiten 349-358. Volltext nicht online.

  King, W. F. III (1996) Rapporteur's Report: Session 5. Journal of Sound and Vibration 193 (1996) 387-389.. Volltext nicht online.

  King III, W. F. (1995) A Brief Survey of Developments in the Aeroacoustics of Fast Trains. In: Proc. 5th Int. Workshop on Railway- and Tracked Systems Noise (1995). 5th Int. Workshop on Railway- and Tracked Systens Noise, Voss, Norway, 21-24 June 1995. Volltext nicht online.

  King III, W. F. (1995) Radiated Aerodynamic Noise Generated by High-Speed Tracked Vehicles. Transportation Research Record No. 1475, National Res. Council Washington, DC, 1995, Seiten 59-65. National Academic Press. Volltext nicht online.

  King III, W. F. (1996) Aerodynamic noise sources on high-speed trains. Harris, Miller, Miller and Hanson Inc., 22 June 1996.. Volltext nicht online.

  King III, W. F. und Herrmann, M. und Neuhaus, L. und Pfizenmaier, E. (1996) Aeroakustische Untersuchungen an modifizierten Auflaufhoernern und Hubbegrenzungsbuegeln fuer den DSA-350-SEK-Stromabnehmer. DLR-Interner Bericht. 92517-96/B6, 67 S. Volltext nicht online.

  King III, W. F. und Herrmann, M. und Neuhaus, L. und Pfizenmaier, E. (1996) Experimentelle akustische Untersuchungen an 1:10 Modellkomponenten des ICE 2.2 im akustischen Windkanal der DLR in Braunschweig. DLR-Interner Bericht. 92517-96/B7, 24 S. Volltext nicht online.

  King III, W. F. und Herrmann, M. und Pfizenmaier, E. (1996) Aeroakustische Untersuchungen an modifizierten Auflaufhoernern und Hubbegrenzungsbuegeln fuer den DSA-350-SEK-Stromabnehmer (vorl. Bericht). DLR-Interner Bericht. 92517-96/B3, 17 S. Volltext nicht online.

  King III, W. F. und Pfizenmaier, E. (1995) Statusbericht über Schallquellmechanismen an Hochgeschwindigkeitsstromabnehmern und Maßnahmen zu deren Reduktion. DLR-Interner Bericht. 92517-95/B4, 75 S. Volltext nicht online.

  King III, W. F. und Pfizenmaier, E. und Barsikow, B. (1) und Herrmann, M. und Klemenz, M. (1) und Neuhaus, L. und Schüttpelz, M. (1) (1996) Experimentelle akustische Untersuchungen an 1:10 Modellkomponenten des ICE 2.2 im akustischen Windkanal der DLR in Braunschweig. DLR-Interner Bericht. 92517-96/B10, Teile I und II (1996), 164 S. Volltext nicht online.

  King III, W. F. und Pfizenmaier, E. und Herrmann, M. (1996) Acoustical investigations of a full-scale DSA-350-SEK pantograph in an anechoic open-jet wind tunnel. DLR-Interner Bericht. 92517-96/B4, 70 S. Volltext nicht online.

  King III, W. F. und Pfizenmaier, E. und Herrmann, M. (1996) On abating aerodynamic sound generated by components of high-speed pantographs. DLR-Interner Bericht. 92517-96/B9, 16 S. Volltext nicht online.

  King III, W. F. und Pfizenmaier, E. und Herrmann, M. und Neuhaus, L. (1996) An experimental study of sound generated by flow interactions with cylinders. DLR-Interner Bericht. 92517-96/B11, 91 S. Volltext nicht online.

  King III, W. F. und Pfizenmaier, E. und Neuhaus, L. (1995) Experimental Investigations of 1:10 ICE 2.2 Models in the Aeroacoustic Windtunnel (AWB) of the DLR in Braunschweig. DLR-Interner Bericht. 92517-95/B9, 73 S. Volltext nicht online.

  King III, W. F. und Pfizenmaier, E. und Neuhaus, L. (1995) Experimentelle Untersuchungen an 1:10-Modellen des ICE 2.2 im Akustik-Windkanal der DLR in Braunschweig (Schlussbericht). DLR-Interner Bericht. 92517-95/B10, 131 S. Volltext nicht online.

  King III, W.F. (1997) Sound generated by flow interactions with slender bodies and its abatement. 2nd International Workshop on the Aeroacoustics of High-Speed Trains, Berlin, 29.4.1997. Volltext nicht online.

  King III, W.F. und Pfizenmaier, E. und Herrmann, M. (1997) Schallquellen an Hochgeschwindigkeitsstromabnehmern und Moeglichkeiten zu deren Reduktion. DLR-Interner Bericht. 92517-97/B1, 119 S. Volltext nicht online.

  Klevenz, T. (1996) Berechnung und Analyse des Brennkammerzustandes in kryogenen Hockdruck-H2/O2-Raketentriebwerken. Projektbericht. Volltext nicht online.

  Klinner, Joachim (2017) Development and assessment of volume resolving velocimetry for turbomachinery test facilities. Dissertation. DLR-Forschungsbericht. DLR-FB-2017-52, 194 S. file

  Klinner, Joachim und Freitag, Stefan und Hassa, Christoph und Willert, Christian (2017) Implementation of tomographic shadowgraphy in a generic aero engine burner at elevated pressure and temperature. Measurement and Observation Techniques for Aerospace Research (MOTAR), 26. - 27. April 2017, Berlin. Volltext nicht frei. file

  Klinner, Joachim und Willert, Christian (2017) Measurements of Turbulent Jet Mixing in a Turbulent Co-Flow Including the Influence of Periodic Forcing and Heating. Flow Turbulence and Combustion, 98 (3), Seiten 751-779. Springer. DOI: 10.1007/s10494-016-9789-3 ISSN 1386-6184 Volltext nicht frei. filefilefile

  Klinner, Joachim und Willert, Christian und Förster, Wolfgang und Beversdorff, Manfred und Mayer, Valentin (2015) Simultaneous PLIF/PIV measurements of pulsating and heated coaxial jets in a turbulent channel flow. Begell House inc., New York, Wallingford (UK). ISBN 978-1-56700-427-4. ISSN 2377-2816 Volltext nicht frei. filefilefilefilefile

  Koene, E. (2001) DatPWG - Design of the Data Acquisition for a New Large Scale Facility for Aerodynamics and Heat Transfer Measurements on a Turbine Platform. DLR-Interner Bericht. 225-2001 A 07, 40 S. Volltext nicht online.

  Kompenhans, J. und Schröder, A. und Raffel, M. und Kähler, C. und Arnott, A. und Bao, F. und Sammler, B. und Schneider, G. und Stasicki, B. und Frahnert, H. und Klinge, F. und Vollmers, H. und Agocs, J. und Mattner, H. und Stanislas, M. und Hinsch, K. und Westerweel, J. und Willert, C. und Ehrenfried, K. und Micknaus, I. und Rosenstock, C. und Henze, D. (2003) Application of Particle Image Velocimetry, Theory and Practice. In: Application of Particle Image Velocimetry, Theory and Practice, Ordner-. PIV-Course, Göttingen, Germany, 03.03.-07.03.2003. Volltext nicht online.

  Kompenhans, J. und Schröder, A. und Raffel, M. und Kähler, C. und Arnott, A. und Bao, F. und Sammler, B. und Schneider, G. und Stasicki, B. und Frahnert, H. und Kuduz, M. und Klinge, F. und Vollmers, H. und Agocs, J. und Mattner, H. und Stanislas, M. und Hinsch, K. und Westerweel, J. und Willert, C. und Micknaus, I. und Rosenstock, C. (2002) Application of Particle Image Velocimetry, Theory and Partice. In: Application of Particle Image Velocimetry, Theory and Partice, Ordner-. PIV-Course, Göttingen, Germany, 04.03.-08.03.2002. Volltext nicht online.

  Kompenhans, Jürgen und Dieterle, Lutz und Richard, Hugues und Dewhirst, T. und Vollmers, Heinrich und Kähler, Christian und Ehrendfried, Klaus und Ronneberger, Olaf und Willert, Christian und Pengel, Kurt (2000) Measurement of flow fields with Particle Image Velocimetry. In: Progress in Vehicle Aerodynamics, Seiten 131-157. Expert Verlag, 71272 Renningen. EUROmotor Short course, Progress in Vehicle Aerodynamics - Advanced Experimental Techniques, 2000-03-29 - 2000-03-30, Stuttgart (Germany). ISBN 3-8169-1843-3 Volltext nicht online.

  Kompenhans, Jürgen und Raffel, Markus und Dieterle, Lutz und Dewhirst, T. und Vollmers, Heinrich und Kähler, Christian und Schröder, Andreas und Ronneberger, Olaf und Ehrenfried, Klaus und Willert, Christian und Pengel, Kurt (2000) Particle Image Velocimetry in Aerodynamics: Technology and Applications in Wind Tunnels. Journal of Visualization, Vol. 2 (No. 3/4), Seiten 229-244. Volltext nicht online.

  Kompenhans, Jürgen und Raffel, Markus und Dieterle, Lutz und Dewhirst, T. und Vollmers, Heinrich und Stuff, Roland und Schneider, G. und Kähler, Christian und Ronneberger, Olaf und Willert, Christian und Pengel, Kurt und de Gregorio, F. und Monnier, J. C. (2000) Application of PIV in Large Wind Tunnels. In: Particle Image Velocimetry and Associated Techniques Lecture Series 2000-01, VKI LS 200-01. von Karman Institute, Belgium. 27Seiten. ISBN ISSN 0377-8312. Volltext nicht online.

  Kompenhans, Jürgen und Schröder, Andreas und Willert, Christian und Kähler, Christian (2009) The development of Particle Image Velocimetry towards a versatile experimental tool for turbulence research. Solving the Riddle of Turbulence: What, Why, and How?, 06.- 09. May 2009, Göttingen, Germany. Volltext nicht online.

  Kompenhans, Jürgen und Raffel, Markus und Dieterle, Lutz und Willert, Christian und Kähler, Christian und Richard, Huge und Schröder, Andreas und Vollmers, Heinrich und Schneider, Gert und Stasicki, Boleslaw und Agocs, Janos und Micknaus, Ilka und Stanislas, Michel und Hinsch, Klaus und Westerweel, Jerry (2000) Application of Particle Image Velocimetry - Theory and Partice. Course Notes, Ordner. Volltext nicht online.

  Konle, Holger und Rausch, Anne und Fischer, Andre und Doll, Ulrich und Willert, Christian und Paschereit, Oliver und Roehle, Ingo (2009) Development of optical measurement techniques for thermo-acoustic diagnostics: fibre-optic microphone, Rayleigh-scattering, and acoustic PIV. International Journal of Spray and Combustion Dynamics, 1 (2), Seiten 251-282. Sage Publications. ISSN 1756-8277 Volltext nicht online.

  Koopman, J. (1997) Numerische und experimentelle Untersuchung zweier Fett-Mager Brennkammern. DGLR-Fachausschuss-Sitzung &quot;Schadstoffarme Verbrennung in Fluggasturbinen&quot;, Dresden, 6.-7. Nov. 1997. Volltext nicht online.

  Koopman, J. (1991) CFD-Applications for Combustion Chamber Flows. R&D Working Group &quot;Airbreathing Propulsion&quot; in the BMFT Hypersonic Techn. Progr., Vortr. 18.03.91 TU Stuttgart. Volltext nicht online.

  Koopman, J. (1991) CFD-Applications for Combustion Chamber Flows. R&D Working Group &quot;Airbreathing Propulsion&quot; in the BMFT HTP, an der TU Stuttgart am 18.03.1991. Volltext nicht online.

  Koopman, J. und Fischer, M. und Magens, E. und Winandy, A. und Meislitzer, B. (1996) Potential Use of Hydrogen in Propulsion. Subtask &quot;Non Intrusive Measurements&quot;. Projektbericht, DLR-Interner Bericht. Volltext nicht online.

  Koopman, J. und Griebel, P. und Hassa, C. (1996) Numerical and Experimental Investigation of a Rich Quench Lean Combustor Sector. ASME, NY, USA. ASME-96-GT48, International Gas Turbine and Aeroengine Congress, Birmingham, UK, June 10-13, 1996. Volltext nicht online.

  Koopman, J. und Rachner, M. und Wiegand, H. und Eickhoff, H. (1990) Aerodynamics and Stabilization of Combustion of Hydrogen Jets Injected into Subsonic Airflow. In: AGARD Conference Proceedings No. 479 &quot;Hypersonic Combined Cycle Airflow&quot;.. Volltext nicht online.

  Koopman, J. und Rachner, M. und Wiegand, H. und Eickhoff, H. (1990) Aerodynamics and Stabilization of Combustion of H2-Jets Injected into Subsonic Airflow. AGARD 75th Symposium of the PEP on Hypersonic Combined Cycle Propulsi on 1990. Volltext nicht online.

  Koopman, J. und Stursberg, K. (1990) The New Nozzle Test Facility at the DLR Koeln. 2nd Meeting of the R&D Support Group &quot;Aerothermodynamics of Combustio n Chamber and Nozzles&quot;, RWTH Aachen, 8 October 1990. Volltext nicht online.

  Koopman, J.W. und Hassa, Ch. und Griebel, P. und Theisen, P. (1998) Investigation of a Rectangular Rich-Quench-Lean Combustor Sector. ASME. 43rd ASME Gas Turbine and Aeroengines Congress, Stockholm, Schweden, June 1998. Volltext nicht online.

  Koopman, Johannes und Hassa, Christoph (2004) Numerical Design of an Axially Staged Low Emission Gas Turbine Combustor. In: Proceedings: Trends in Numerical and Physical Modelling of Turbulent Processes in Gasturbine Combustors, 2, Seiten 119-124. 2nd (International) SBF568-WORKSHOP : Trends on Numerical and Physical Modelling of Turbulent Processes in Gas Turbine Combustors, Heidelberg, April 1, 2 - 2004. Volltext nicht online.

  Kost, F. (2001) Experimental Investigation of the Flow Field within the Honda-ES-Rotor at the Windtunnel for Rotating Cascades (RGG). DLR-Interner Bericht, Projektbericht. 225-2001 C 05, 92 S. Volltext nicht online.

  Kost, F. (2001) Messungen am ebenen Turbinengitter BRR-HP1 mit Ausblasen aus Reihe SS3. DLR-Interner Bericht, Projektbericht. 225-2001 C 02, 80 S. Volltext nicht online.

  Kost, F. (2004) Low Reynolds Number Rotor Tests for the Honda-ALR-Profile at the Windtunnel for Rotating Cascades (RGG). DLR-Interner Bericht. 225-2003 C 02, 126 S. Volltext nicht online.

  Kost, F. (2003) Experimental Investigation of Flow and Endwall Heat Transfer at Siemens-NGF-50-Cascade. DLR-Interner Bericht. 225-2003 C 03, 52 S. Volltext nicht online.

  Kost, F. (2004) Experimental Investigation of the Flow Field within a Turbine Rotor Cascade with Rear Pressure Side Coolant Ejection. Appendix A. DLR-Interner Bericht. 225-2004 C02A, 99 S. Volltext nicht online.

  Kost, F. (2004) Experimental Investigation of the Flow Field within a Turbine Rotor Cascade with Rear Pressure Side Coolant Ejection. DLR-Interner Bericht. 225-2004 C02, 33 S. Volltext nicht online.

  Kost, F. (2004) Experimental Investigation of the Flow Field within a Turbine Stator Cascade. DLR-Interner Bericht. 225-2004 C 09, 62 S. Volltext nicht online.

  Kost, F. (2005) Eichung einer Kulite-Pitotsonde und Beschreibung der Auswerteprozedur. DLR-Interner Bericht. 225-2005 A 03, 33 S. Volltext nicht online.

  Kost, F. (2005) Überprüfung der Kalibration einer 4-Loch-Sonde. DLR-Interner Bericht. 225-2005 C 06, 21 S. Volltext nicht online.

  Kost, F. und Gieß, P.-A. (2004) Experimental Turbine Research at DLR Göttingen. Journal of the Gas Turbine Society of Japan, Vol. 32 (No. 6), Seiten 47-56. Volltext nicht online.

  Kost, F. und Hamkar, A. M. (2004) Experimental Investigation of the Flow Field within a Turbine Stator Cascade. Appendix A: Results without Coolant Ejection. DLR-Interner Bericht. 225-2004 C09 A, 95 S. Volltext nicht online.

  Kost, F. und Hamkar, A.W. und Mullaert, A. (2005) Messung der Geschwindigkeit und der Kühlluftkonzentration mit Hilfe des L2F-Gerätes bei Plattformkühlung eines Turbinenstators. DLR-Interner Bericht. 225-2004 A 07, 71 S. Volltext nicht online.

  Kost, F. und Nicklas, M. (2001) Film-Cooled Turbine Endwall in a Transonic Flow Field. Part I - Aerodynamic Measurements. In: ASME TURBO EXPO 2001. ASME TURBO EXPO 2001, New Orleans, USA, 4.-7. Juni 2001, New Orleans, USA. Volltext nicht online.

  Kost, F. und Willburger, A. (2003) Experimental Investigation of Flow and Endwall. Appendix A. DLR-Interner Bericht. 225-2003 C 03A, 118 S. Volltext nicht online.

  Kozulovic, D. und Röber, T. K. und Kügeler, E. und Nürnberger, D. (2004) Modifications of a Two-Equation Turbulence Model for Turbomachinery Fluid Flows. In: DGLR Jahrbuch, 1 und 2. DGLR. Deutscher Luft- und Raumfahrtkongress, Dresden, 20.09.2004. Volltext nicht online.

  Krain, H. (1998) Kennfeld- und Lasermessungen mit abgedrehtem Laufrad SRV2. FVV-Arbeitskreissitzung &quot;Transsonische Radialverdichter&quot;, TU Hannover, 27. März 1998. Volltext nicht online.

  Krain, H. (1998) Meßergebnisse an der modifizierten Radialverdichterstufe mit beschaufeltem Diffusor. FVV-Arbeitskreissitzung &quot;Transsonische Lauf-Leitradinteraktion bei Radialverdichtern&quot;, DLR, Köln, 4. Nov. 1998. Volltext nicht online.

  Krain, H. (1999) High Pressure Ratio Centrifugal Compressor with Transonic Flow. Proceedings of the 3rd ASME/ISME Joint Fluids Eng. Conference, July 18-23, 1999. Volltext nicht online.

  Krain, H. (1999) Analysis of Transonic Flow Fields inside a High Pressure Ratio Centrifugal Compressor at Design and Off Design Conditions. In: ASME-Paper, 99-GT-446, 15-. ASME, Indianapolis, June 1999. Volltext nicht online.

  Krain, H. (1999) Transsonische Lauf-Leitrad Interaktion bei Radialverdichtern. In: Informationstagung Turbinen, Seiten 69-83. FVV-Frühjahrstagung, Frankfurt, 14.4.1999. Volltext nicht online.

  Krain, H. (1999) Messung der instationären Strömung im Eintrittsbereich eines beschaufelten Diffusors. FVV-Arbeitskreissitzung, Berlin, 16.03.99. Volltext nicht online.

  Krain, H. (2000) Unsteady Diffusor Flow in a Transonic Centrifugal Compressor. Proceedings of the 8th International Symposium on Transport Phenomena and Dynamics of Rotating Machinery (ISROMAC, 26-30 March 2000, Honolulu, USA. Volltext nicht online.

  Krain, H. (2000) Instationäre Diffusorströmung. FVV-Arbeitskreissitzung &quot;Transsonische Lauf-Leitrad Interaktion bei Radialverdichtern, DLR-Köln, 14. März 2000. Volltext nicht online.

  Krain, H. (2001) Transsonische Lauf-/Leitrad Interaktion bei Radialverdichtern. Forschungsvereinigung Verbrennungskraftmaschinen, Deutschland. FVV-Abschlussbericht, 2001. Volltext nicht online.

  Krain, H. (2001) Unsteady Diffuser Flow of a Transonic Centrifugal Compressor. In: Symposium on Air Breathing Engines, Seiten 1-9. 15th International Symposium on Air Breathing Engines, ISABE, Bangalore, India, 3.-7. Sept. 2001. Volltext nicht online.

  Krain, H. (2002) Investigations of the Flow through a High Pressure Ratio Centrifugal Impeller. In: ASME Turbo Expo, CD, Seiten 1-9. ASME, Atlanta, USA. ASME Turbo Expo 2002, Amsterdam, Netherlands, June 3-6, 2002. Volltext nicht online.

  Krain, H. (2002) Unsteady Diffuser Flow in a Transonic Centrifugal Compressor. International Journal of Rotating Machinery, 8 (3), Seiten 223-231. Volltext nicht online.

  Krain, H. (2003) Review of Centrifugal Compressor's Application and Development. ASME. Volltext nicht online.

  Krain, H. (2004) Homogene Lauf-/Leitradströmung: Stand der experimentellen Arbeiten. Arbeitskreissitzung &quot;Radialverdichter&quot;, Köln, 18.02.2004. Volltext nicht online.

  Krain, H. (2002) Homogene Lauf-/Leitradströmung: Festlegung der Radgeometrie des SRV4. Arbeitskreissitzung &quot;Radialverdichter&quot;, Köln, 14.11.2002. Volltext nicht online.

  Krain, H. (1989) Survey of the DLR-Centrifugal Compressor Research Activities. Seminarvortrag bei: KHD-Luftfahrttechnik GmbH, Oberursel, 1. Jun. 1989, Sundstrand Corporation, Rockford, Illionois, USA, 9. Jun. 1989, Garrett Engine Division, Phoenix, Arizona, USA, 12. Jun. 1989. Volltext nicht online.

  Krain, H. (1989) Entwurfsverfahren für hochbelastete Radialverdichter. Seminarvortrag, 13.Dezember 1989. Volltext nicht online.

  Krain, H. (1988) Design Procedure for Centrifugal Impellers. Seminarvortrag, 15. Sept. 1988. Volltext nicht online.

  Krain, H. (1988) Experimental and Theoretical Investigation of the Flow in Centrifugal Compressors. In: Advanced Centrifugal Compressor Performance Course Notes, Sept. 1988, Seiten 1-62. Seminar. Volltext nicht online.

  Krain, H. (1988) Swirling Impeller Flow. Transact. of the ASME, Journal of Turbomachinery, Vol. 110, Seiten 122-128. Volltext nicht online.

  Krain, H. (1987) Secondary Flow Measurements with L2F Technique in Centrifugal Compressors. AGARD Proceedings, AGARD CP-421 (PEP Meeting, 69th Symposium, Paris, France, 4.-8. Mai 1987), 34.1-34.10. Volltext nicht online.

  Krain, H. (1987) DFVLR Centrifugal Compressor Research Activities. Seminarvortrag gehalten bei: General Electric, Lynn, Ma., USA, 28.5.1987, Turbomach, San Diego, Ca., USA, 8.6.1987. Volltext nicht online.

  Krain, H. (1987) Swirling Impeller Flow. American Society of Mechanical Engineering, ASME-Paper (87-GT-19), Seiten 1-8. Volltext nicht online.

  Krain, H. (1987) Experimental and Theoretical Analysis of Centrifugal Compressor Impeller Flow. In: Proceedings of the Institution of Mechanical Engineers, Seiten 199-210. I Mech E, Robinson College, Cambridge, England, 1.-3. Sept. 1987. Volltext nicht online.

  Krain, H. (1987) Auslegung von Radialrädern: Programmbeschreibung. DLR-Interner Bericht. 325-11-87, 18 S. Volltext nicht online.

  Krain, H. (1986) Experimental Analysis and Prediction of the Flow Field inside Cemtrifugal Compressor Impellers. In: Centrifugal Compressor Design and Performance. Seminar on: Centrifugal Compressor Design and Performance, DFVLR-Köln, June 13-20, 1986. Volltext nicht online.

  Krain, H. (1986) Sekundärströmungsanalyse in Radialverdichtern. Fachkolloquium. 25 Jahre DFVLR-Antriebstechnik in Köln-Porz. Volltext nicht online.

  Krain, H. (1986) Auslegungsverfahren für Radialräder hohen Druckverhältnisses. Zentrumskolliquium DFVLR-AVA. Göttingen, 23. Okt. 1986. Volltext nicht online.

  Krain, H. (1986) Überprüfung eines Aslegungsverfahrens für Radialräder mit Hilfe experimenteller Ergebnisse. In: Berechnung von Strömungen in Turbomaschinen und Vergleich mit experimentellen Untersuchungen. Fachtagung Nr.: T-30-809-051-6. Volltext nicht online.

  Krain, H. (1985) Experimentelle Analyse der Strömung in Radialrädern und Neuauslegung mit Hilfe eines CAD-Systems. Seminarvortrag, TH-Aachen, 31. Okt. 1985. Volltext nicht online.

  Krain, H. (1985) Auslegung von Radialrädern mit Hilfe der EDV. Seminarvortrag an der Universität der Bundeswehr, Hamburg, 24. Juni 1985. Volltext nicht online.

  Krain, H. (1985) DFVLR-Centrifugal Compressor Activities. Seminarvortrag, gehalten bei: United Technologies Research Center, Hartford, Conn., USA, 11.03.1985, NASA Lewis, Cleveland, Ohio, USA, 13.03.1985, Sundstrand Corporation, Rockford, Illinois, USA, 15.03.1985, Solar Turbines, San Diego, Calif., USA, 25.03.. Volltext nicht online.

  Krain, H. (1985) Interdependence of Centrifugal Compressor Blade Geometry and Relative Flow Field. ASME-Paper, 85-GT-95, Seiten 1-7. Volltext nicht online.

  Krain, H. (1985) Ergebnisse der Kennfeldmessungen am neuen rückwärtsgekrümmten Radialrad. FVV-Arbeitskreis &quot;Radialverdichter&quot;, TU-Hannover, 5. Febr. 1985. Volltext nicht online.

  Krain, H. (1984) Experimental Observation of the Flow in Impellers and Diffusers. In: Flow in Centrifugal Compressors LS-1984-07, VKI-Lecture Series 1984-07. VKI. ISBN 1. Volltext nicht online.

  Krain, H. (1984) A CAD Method for Centrifugal Compressor Impellers. Transactions of the ASME, Transactions of the ASME, Journal of Engineering for Gas Turbines and Power (Vol. 106, Appr. 1984), Seiten 482-488. Volltext nicht online.

  Krain, H. (1983) Erweiterung des Auslegungsverfahrens für rückwärtsgekrümmte Radialräder hohen Druckverhältnisses. DLR-Interner Bericht. 325-11-83, 69 S. Volltext nicht online.

  Krain, H. (1983) A CAD-Method for Centrifugal Compressor Impellers. ASME-Paper, 83-GT-65, Seiten 1-7. Volltext nicht online.

  Krain, H. (1983) Laser Measurements within a Centrifugal Compressor and Centrifugal Impeller Design. Seminar, Cleveland, Ohio, USA, 24. March 1983. Volltext nicht online.

  Krain, H. (1982) Experimental and Theoretical Investigation on the Fluid Dynamics of a Centrifugal Compressor Stage. In: Proceedings of CASI, 1982 1982, 1. CASI. ISBN 1. Volltext nicht online.

  Krain, H. (1982) The DFVLR-Centrifugal Compressor Activities. Seminarvortrag, gehalten bei: General Electric, Lynn, Mass., USA, 27.04.1982, Pratt&Whittney, Montreal, Canada, 29.04.1982, Detroit Diesel Allison, Indianapolis, USA, 07.05.1982. Volltext nicht online.

  Krain, H. (1982) Grenzschichtrechenverfahren und ihre Anwendung im Radialverdichter. Seminarvortrag, Institut für Antriebstechnik, DFVLR-Köln. Volltext nicht online.

  Krain, H. (1982) Auslegungsverfahren für Radialverdichterlaufräder mit CAD/CAM-Unterstützung. FVV-Arbeitskreissitzung Radialverdichter. Volltext nicht online.

  Krain, H. (1981) Ein Auslegungsverfahren für rückwärtsgekrümmte Radialräder hohen Druckverhältnisses. DLR-Interner Bericht. 325-13-1981, 157 S. Volltext nicht online.

  Krain, H. (1981) Analyse von Strömungsvorgängen in Radialverdichtern und Folgerungen für die Auslegung. Triebwerkskolloquium: 20 Jahre Triebwerksforschung in Köln-Porz, 10. Dez. 1981. Volltext nicht online.

  Krain, H. (1981) A Study on Centrifugal Impeller and Diffuser Flow. Transactions of the ASME, Journal for Engineering for Power (Volume 103, Number 4, October 1981), Seiten 688-697. Volltext nicht online.

  Krain, H. (1981) Radialverdichterauslegung für Turboaufladung mit Zusatzantrieb bei begrenzter Drehzahl. Seminarvortrag, DFVLR-Köln. Volltext nicht online.

  Krain, H. (1981) Centrifugal Compressor Research Activities at DFVLR Cologne. Seminar, Garrett Turbines, Phoenix, AZ., USA, 5. March 1981. Volltext nicht online.

  Krain, H. (1981) Studie zur Turboaufladung eines PKW-Dieselmotors mit Zusatzantrieb. Projektbericht, DLR-Interner Bericht. ohne. Volltext nicht online.

  Krain, H. (1980) Experimental and Theoretical Investigations on the Internal Flow in a Centrifugal Compressor Diffuser. In: Centrifugal Compressors, Flow Phenomena and Performance AGARD Conference Proceedings, AGARD-CP-282. AGARD. ISBN 1. Volltext nicht online.

  Krain, H. (1979) Ergebnisse der Leistungsmessungen an einer Radialverdichterstufe mit beschaufeltem Diffusor. FVV-Arbeitskreissitzung &quot;Radialverdichter&quot;, Köln, 13. Nov. 1979. Volltext nicht online.

  Krain, H. (1979) Erste experimentelle und theoretische Ergebnisse der Untersuchungen an einer Radialverdichterstufe mit beschaufeltem Diffusor. DLR-Interner Bericht. 352-79/9, 33 S. Volltext nicht online.

  Krain, H. (1979) Experimentelle und theoretische Arbeiten am Radialverdichter der DFVLR. FVV-Arbeitskreissitzung, TU-Hannover, 13.03.1979. Volltext nicht online.

  Krain, H. (1979) Das integrale Grenzschichtverfahren Walz II, seine numerische Behandlung und vergleichende Rechenergebnisse. DLR-Interner Bericht. 352-79/1, 47 S. Volltext nicht online.

  Krain, H. (1978) Laufende Forschungsarbeiten am Radialverdichter der DFVLR. FVV-Arbeitskreissitzung, ETH-Zürich, 6. Okt. 1978. Volltext nicht online.

  Krain, H. (1978) Auslegung einer Radialverdichterstufe hohen Druckverhältnisses, insbesondere im Hinblick auf den beschaufelten Diffusor. DLR-Interner Bericht. 352-78-9, 104 S. Volltext nicht online.

  Krain, H. (1997) Transsonische Radialverdichter. Seminarvortrag, Universität Karlsruhe, 22. Jan. 1997. Volltext nicht online.

  Krain, H. (1983) Erweiterung des Auslegungsverfahrens für rückwärtsgekrümmte Radialräder hohen Druckverhältnisses. DLR-Interner Bericht. 325-11-83, 69 S. Volltext nicht online.

  Krain, H. (2004) Homogene Lauf-/Leitradströmung, Experimentelle Ergebnisse mit dem SRV4. FVV-Sitzung Radialverdichter, 20.10.2005. Volltext nicht online.

  Krain, H. (2005) Review of Centrifugal Compressor's Application and Development. In: Transactions of the ASME, Journal of Turbomachinery January 2005, Volume 127, pp. 25-34. ASME. ISBN 1. Volltext nicht online.

  Krain, H. (1975) Beitrag zur Berechnung der quasi-dreidimensionalen Strömung in Radialverdichter-Laufrädern. Dissertation, RWTH-Aachen. Volltext nicht online.

  Krain, H. (1990) 3D-Stroemungsrechnungen in Turbomaschinen. Seminarvortrag bei ABB, 15. November 1990, Baden, Schweiz. Volltext nicht online.

  Krain, H. (1990) Experimemntal and Theoretical Analysis of the Flow in Centrifugal Compressors. 1990 ASME/IGTI Fluid Dynamics of Turbomachinery Program, 13-23 August 1990, Ames, Iowa. Volltext nicht online.

  Krain, H. (1991) Future DLR-Turbomachinery Research. ERCOFTAC-Meeting on Internal Flows in Turbomachines, Grenoble (F), 24./25.01.91. Volltext nicht online.

  Krain, H. (1991) Analyse der Radialverdichterströmung. Fachkolloquium RWTH-Aachen, Aachen, 15.02.91. Volltext nicht online.

  Krain, H. (1991) Erläuterungen zur Auslegung des ersten Läufers für den neuen Radialverdichterprüfstand der DLR. FVV-Arbeitsskreissitzung, DLR-Köln, 22.04.91. Volltext nicht online.

  Krain, H. (1991) Stand der experimentellen Arbeiten am schnellaufenden Radialverdichter. FVV-Arbeitskreissitzung bei der DLR-Köln, 23.10.91. Volltext nicht online.

  Krain, H. (1991) Centrifugal Compressor Flow Analysis Measurement and Calculation. Seminarvortrag ONERA-Besuch bei DLR-Köln, 05.12.91. Volltext nicht online.

  Krain, H. (1992) High pressure ratio compressors. Short Course on Design of Radial and Mixed Flow Compressors, Cranfield Inst. of Technology, 2.-6.03.92, Cranfield, UK. Volltext nicht online.

  Krain, H. (1992) Kennfeldmessungen an einem Laufrad mit hohem Druckverhältnis. FVV-Arbeitskreissitzung &quot;Radialverdichter hoher Schluckfähigkeit&quot;, 05.02.92, BMW-RR, Oberursel. Volltext nicht online.

  Krain, H. (1992) Test Case 2: Centrifugal Impeller. In: European Research Community on Flow Turbulence and Combustor (ERCOFTAC), Turbomachinery Special Interest Group. Seminar and Workshop on &quot;3D Turbomaschinery Flow Prediction&quot;, 07.12.92, France. Volltext nicht online.

  Krain, H. (1992) Meßergebnisse mit dem SRV1-Rad. FVV-Arbeitskreissitzung &quot;Radialverdichter hoher Schluckfähigkeit&quot;, 16.09.92 bei Sulzer-Escher-Wyss, Zürich, Schweiz. Volltext nicht online.

  Krain, H. (1993) Messungen an einem Radialrad mit transsonischer Anstroemung. Seminarvortrag 28.04.1993, ABB Baden, Baden/Schweiz. Volltext nicht online.

  Krain, H. (1993) Fertigung des Laufrades SRV2 und Modifikationen am Radialverdichterpruefstand. FVV-Arbeitskreissitzung &quot;Radialverdichter hoher Schluckfaehigkeit&quot; 17.02.1993, DLR-Koeln. Volltext nicht online.

  Krain, H. (1993) Centrifugal Compressor Activities at DLR. Seminarvortrag 01.Juni 9193, United Technologies Research Center East Hartford, Connecticut, USA. Volltext nicht online.

  Krain, H. (1993) Abschliessende Lasermessungen am SRV1 und erste Messergebnisse fuer das Laufrad SRV2. FVV-Arbeitskreissitzung &quot;Radialverdichter hoher Schluckfaehigkeit&quot; 29.Okt. 1993, Frankfurt. Volltext nicht online.

  Krain, H. (1993) Validation Test Case for Threedimensional Unsteady Calculations. NREC-Workshop on &quot;Design and Development of Centrifugal Compressors&quot;, New York 9-10.93, Milan, Italy. Volltext nicht online.

  Krain, H. (1994) Erste 3D-Rechenergebnisse fuer ein Radialverdichterlaufrad mit zurueckgeschnittenen Schaufeln und transsonischer Anstroemung. FVV-Arbeitskreissitzung &quot;Radialverdichter hoher Schluckfaehigkeit&quot;, 21.04.1994, DLR Koeln. Volltext nicht online.

  Krain, H. (1994) Centrifugal Impeller, Test Case II. ERCOFTAC, Seminar and Workshop on 3D Turbomachinery Flow PredictionII 10-13 January 1994, Val d'Isere, France. Volltext nicht online.

  Krain, H. (1994) Vergleich zwischen 3D-Rechenergebnissen und Lasermessungen fuer ein Radialrad mit transsonischer Anstroemung. FVV-Arbeitskreissitzung &quot;Radialverdichter hoher Schluckfaehigkeit&quot;, 27.10.1994, GHH Oberhausen. Volltext nicht online.

  Krain, H. (1994) Auslegung eines beschaufelten Diffusors fuer einen Radialverdichter mit hohem Stufendruckverhaeltnis. FVV-Arbeitskreissitzung &quot;Radialverdichter hoher Schluckfaehigkeit&quot;, 14.12.1994, DLR-Koeln. Volltext nicht online.

  Krain, H. (1995) Test Case II: &quot;Centrifugal Impeller&quot;. ERCOFTAC, Seminar and Workshop on 3D Turbomachinery Flow Prediction II, 9-12 January 1995, Les Arcs, France. Volltext nicht online.

  Krain, H. (1995) Auslegung eines Radialdiffusors mit transsonischer Anströmung. FVV-Arbeitskreissitzung &quot;Radialverdichter&quot;, 30. März 1995, TU Berlin. Volltext nicht online.

  Krain, H. (1995) Radialverdichter hoher Schluckfähigkeit. FVV-Informationstagung Turbinen, 5. April 1995, Frankfurt am Main. Volltext nicht online.

  Krain, H. (1995) Reasearch on High Pressure Ratio Impellers. Seminarvortrag, NASA-Lewis, Cleveland, Ohio, USA, 1. Juni 1995. Volltext nicht online.

  Krain, H. (1996) High Pressure ratio centrifugal compressors: design and research. Colloquium on Turbomachinery 1996, May 5-8 1996, Seoul National University, Korea. Volltext nicht online.

  Krain, H. (1996) Aerodynamics of a Centrifugal Compressor with Transonic Flow. Symposium on Turbomachinery Research, RWTH Aachen, March 21 and 22, 1996. Volltext nicht online.

  Krain, H. (1996) Forschungsvereinigung Verbrennungskraftmaschinen-Radialverdichter hoher Schluckfaehigkeit. In: Proc. Informationstagung Turbinen der FW, Heft R 487 (1996), Seiten 127-144. Forschungsvereinigung Verbrennungskraftmasch. e.V. Frankfurt a. Main. Informationstagung Turbinen der FVV, Frühjahr 96, Heft R487,Abschlußbericht über das Vorhaben &quot;Radialverdichter hoher Schluckfähigkeit&quot;.. Volltext nicht online.

  Krain, H. (1996) Vergleich der 3D-Rechenergebnisse fuer die Laufraeder SRV2 und SRV3. FVV-Arbeitskreissitzung &quot;Radialverdichter hoher Schluckfaehigkeit&quot;, MAN/B&W, Augsburg, 24.4.1996. Volltext nicht online.

  Krain, H. (1996) Lasermessungen am SRV3 Laufrad und 3D-Rechenergebnisse. FVV-Arbeitskreissitzung &quot;Radialverdichter&quot; bei Holset Engineering Deutschland GmbH, Dresden, 7. Nov. 1996. Volltext nicht online.

  Krain, H. (1998) Radialverdichter mit transsonischer Strömung. Kolloquium Fluid- und Thermodynamik, Universität-Gesamthochschule Siegen, 6.2.1998. Volltext nicht online.

  Krain, H. (1998) Kennfeld- und Lasermessungen an schaufellosem, schrägem Diffusor. FVV-Arbeitskreissitzung &quot;Transsonische Radialverdichter&quot;, DLR-Koeln, 21. Jan. 1998. Volltext nicht online.

  Krain, H. (1997) Experimentelle Untersuchungen an einer transsonischen Radialverdichterstufe mit beschaufeltem Diffusor. FVV-Arbeitskreis &quot;Transsonische Radialverdichter&quot;, PGW-Leipzig, 5. Nov. 1997. Volltext nicht online.

  Krain, H. (1997) Lasermeßergebnisse für das Radialrad SRV3. FVV-Arbeitskreis &quot;Radialverdichter mit hoher Schluckfähigkeit&quot;, 22. April 1997, ABB-Baden, Schweiz. Volltext nicht online.

  Krain, H. und Eckardt, D. (1978) The Flow Field in a High Speed Centrifugal Compressor Impeller. A Comparison of Experimental and Theoretical Results. First International Conference on Centrifugal Compressor Technology, Feb. 20.-23rd 1978. Volltext nicht online.

  Krain, H. und Hah, C. (2003) Numerical and Experimental Investigation of the Unsteady Flow Field in a Transonic Centrifugal Compressor. In: The International Gas Turbine Congress 2003, Tokyo, Japan, IGTC'03 Tokyo, Seiten 1-9. The International Gas Turbine Congress 2003, Tokyo, Japan. Volltext nicht online.

  Krain, H. und Hoffmann, B. (1998) Aerodynamics of a Centrifugal Compressor Impeller with Transonic Inlet Conditions. ASME Summer Meeting, Washington DC, June 1998. Volltext nicht online.

  Krain, H. und Hoffmann, B. (2003) Zwischenbericht über das Vorhaben Nr.: 798 &quot;Homogene Lauf-Leitradströmung im Radialverdichter&quot;. Projektbericht. Heft R 522 Volltext nicht online.

  Krain, H. und Hoffmann, B. (1996) Aerodynamics of Centrifugal Compressors with Transonic Flow. In: VKI-Lecture Series 1996-01, &quot;Flow in Radial Turbomachines&quot;. von Karman Inst. for Fluid Dynamics, Brussels, Belgium. Volltext nicht online.

  Krain, H. und Hoffmann, B. und Pak, H. (1995) Aerodynamics of a Centrifugal Compressor Impeller with Transonic Inlet Conditions. In: ASME, Houston, Texas, June 5-8, 1995.. American Society of Mechanical Engineers, Atlanta, Georgia, USA. Volltext nicht online.

  Krain, H. und Hoffmann, B. und Rohne, K.-H. und Eisenlohr, G. und Richter, F.-A. (2007) Improved High Pressure Ratio Centrifugal Compressor. In: ASME TURBO EXPO 2007, Seiten 1-9. ASME TURBO EXPO 2007, 2007-05-14 - 2007-05-17, Montreal, Kanada. Volltext nicht online.

  Krain, H. und Hoffmann, B. und Vogel, T. und Weber, A. (1998) Auslegung einer neuen radialen Endstufe für die Gasturbine THM 1304-10. Projektbericht, DLR-Interner Bericht. 325-09-98. Volltext nicht online.

  Krain, H. und Hoffmann, W. (1989) Verification of an Impeller Design by Laser Measurements and 3D-Viscous Flow Calculations. ASME Paper, ASME (89-Gt-159), Seiten 1-8. Volltext nicht online.

  Krain, H. und Hoffmann, W. (1989) Centrifugal Impeller Geometry and its Influence on Secondary Flows. AGARD Conference Proceedings, AGARD CP (74th PEP-Meeting, Luxemburg), Seiten 1-5. Volltext nicht online.

  Krain, H. und Hoffmann, W. (1990) High Pressure Ration Centrifugal Compressors: Design and Flow Analysis. In: Proceedings; DGLR-Bericht 90-01 (1990).. DGLR, Bonn. European Propulsion Forum 1990 &quot;Future Civil Engines and the Protection of the Atmosphere&quot;, 3-5 April 1990, Koeln-Porz.. Volltext nicht online.

  Krain, H. und Karpinski, G. und Beversdorff, M. (2001) Flow Analysis in a Transonic Centrifugal Compressor Rotor Using 3-Component Laser Velocimetry. In: ASME Turbo Expo 2001, Seiten 1-12. The American Society of Mechanical Engineers, Atlanta, USA. ASME-Tagung, New Orleans, USA, June 2001. Volltext nicht online.

  Krain, H. und Lecht, M. und Plohr, M. (2001) Analyse des Betriebsverhaltens von Turboladern zur Hochdruckaufladung von Dieselmotoren. DLR-Interner Bericht. 325-06-01, 37 S. Volltext nicht online.

  Krain, H. und Pak, H. und Hoffmann, B. (1994) Flow Field Analysis in a High Pressure Ratio Centrifugal Compressor. In: AGARD Paper, 82nd Symposium, 04.-08. Oktober 1993, Montreal, Canada. Volltext nicht online.

  Krain, H. und Rogge, H. (1985) Auslegung und Fertigung von Radialrädern hohen Druckverhältnisses. In: Thermische Strömungsmaschinen 85 572.1, Band 1. Verein Deutscher Ingenieure. ISBN 1. Volltext nicht online.

  Krain, H. und Rymenants, E. (1978) Ein FORTRAN-Programm zur Berechnung der Hauptabmessungen und des Betriebsverhaltens einer hoch belasteten Radialverdichterstufe. DLR-Interner Bericht. 352-78-10, 93 S. Volltext nicht online.

  Krain, H. und Schodl, R. und Binder, A. und Dunker, R. (1986) Success in the Application of Laser Velocimetry in Turbomachinery Studies. In: Advanced Experimental Techniques in Turbomachinery Concepts, ETI. 5-1-5-22. ISBN 1. Volltext nicht online.

  Krain, H. und Schodl, R. und Binder, A. und Dunker, R. (1985) Success in the Application of Laser-Velocimetry to Turbomachinery Studies. Seminar on Advanced Turbomachinery, Universität der Bundeswehr, München, 20.-24. May, 1985. Volltext nicht online.

  Krain, Hartmut (2005) Kennfeldmessergebnisse für eine hoch belastete Radialverdichterstufe, FVV-Arbeitskreissitzung, Köln. [sonstige Veröffentlichung] Volltext nicht online.

  Krain, Hartmut (2006) Transsonische Radialverdichter. [sonstige Veröffentlichung] Volltext nicht online.

  Krain, Hartmut (2007) Survey of Turbomachinery Research at DLR. Chinese Academy of Sciences, Institute of Engineering Thermophysics, Beijing 100080, China. Seminar, 10.September 2007, Peking, China. Volltext nicht online.

  Krain, Hartmut (2008) Lärmoptimierter Radialverdichter großer Kennfeldbreite. FVV-Arbeitskreissitzung Radialverdichter, 2008-01-22, Frankfurt/Main. Volltext nicht online.

  Krain, Hartmut (2008) Kennfeldmessungen am SRV4 mit Kompaktdiffusor. Projektbericht. Volltext nicht online.

  Krain, Hartmut (2008) Kennfeldmessungen am SRV4 mit Kompaktdiffusor. In: ProMeta, FVV-Projektcenter im Internet. FVV-Arbeitskreissitzung Radialverdichter, LärmIII, 2008-26-08, Berlin. Volltext nicht online.

  Krain, Hartmut (2008) Heron ganz im Heute, mit Turbokraft die Umwelt schonen. DLR-Mitteilung. DLR-Nachrichten September 2008/ G 12625. Volltext nicht online.

  Krain, Hartmut (2008) Stand der Arbeiten am SRV4 mit Kompaktdiffusor. Forschungsvereinigung Verbrennungskraftmaschinen. [sonstige Veröffentlichung] Volltext nicht online.

  Krain, Hartmut (2009) Centrifugal Compressor Research at DLR. In: Kyushu University. Graduate School of Engineering Sciences. International Symposium on Transonic Centrifugal Compressors, 2009-01-21, Fukuoka, Kasuga, Kyushu University, Japan. Volltext nicht online.

  Krain, Hartmut und Hoffmann, Bettina (2005) Homogene Lauf-/ Leitradströmung im Radialverdichter. In: Informationstagung Turbinen, Herbst 2005, R532-2005, Köln, Seiten 67-94. Forschungsvereinigung Verbrennunskraftmaschinen. Informationstagung Turbinen, 2005-09-28, Köln (Deutschland). Volltext nicht online.

  Krain, Hartmut und Hoffmann, Bettina (2005) Homogene Lauf-/Leitradströmung. Projektbericht. Volltext nicht online.

  Krain, Hartmut und Hoffmann, Bettina (2005) Lasermess- und 3D-Rechenergebnisse für einen transsonischen Rotor. FVV-AK-Sitzung, S. 1-66, Köln. [sonstige Veröffentlichung] Volltext nicht online.

  Krain, Hartmut und Hoffmann, Bettina (2007) Flow Study of a Redesigned High Pressure Ratio Centrifugal Compressor. In: American Institute of Aeronautics and Astronautics Inc., ISABE-2007 (1223), Seiten 1-9. 18th ISABE Conference, 2007-09-02 - 2007-09-07, Beijing, China. Volltext nicht online.

  Krain, Hartmut und Hoffmann, Bettina (2008) Kompaktdiffusor. In: FVV-Frühjahrstagung 2008, Heft R542-2008, Seiten 131-153. Informationstagung Turbomaschinen, 2008-04-03, Frankfurt/Main. Volltext nicht online.

  Krain, Hartmut und Hoffmann, Bettina (2008) Ergebnisse der Untersuchungen am SRV4 mit Kompaktdiffusor. [sonstige Veröffentlichung] Volltext nicht online.

  Krain, Hartmut und Hoffmann, Bettina (2008) Flow Study of a Redesigned High Pressure Ratio Centrifugal Compressor. AIAA Journal, Volume 24, Number 5, Oct. 2008, Seite 7. American Institute of Aeronautics and Astronautics. Volltext nicht online.

  Krain, Hartmut und Hoffmann, Bettina und Beversdorff, Manfred (2007) Flow Pattern at the Inlet of a Transonic Centrifugal Rotor. International Gas Turbine Congress 2007 Tokyo, 2007-12-02 - 2007-12-07, Tokyo, Japan. Volltext nicht online.

  Krain, Hartmut und Hoffmann, Bettina und Voges, Melanie (2009) Kompaktdiffusor. In: FVV Informationstagung Turbomaschinen, Frühjahrstagung 2009, Heft R546. Forschungsvereinigung Verbrennungskraftmaschinen. FVV Frühjahrstagung 2009, 2009-04-02, Bad Neuenahr. Volltext nicht online.

  Krain, Hartmut und Hoffmann, Bettina und Voges, Melanie (2006) Tischvorlage, FVV-Arbeitskreissitzung. andere. Projektbericht. Volltext nicht online.

  Krain, Hartmut und Hoffmann, Bettina und Voges, Melanie (2006) Tischvorlage FVV-AK-Sitzung Sept. 2006. Projektbericht. Forschungsvereinigung Verbrennungskraftmaschinen, Frankfurt (FVV). Volltext nicht online.

  Krain, Hartmut und Hoffmann, Bettina und Voges, Melanie (2007) FVV-AK-Sitzung, Tischvorlage. Forschungsvereinigung Verbrennungskraftmaschinen, Frankfurt/M. [sonstige Veröffentlichung] Volltext nicht online.

  Krain, Hartmut und Hoffmann, Bettina und Voges, Melanie (2007) Tischvorlage, AK-Sitzung 7.11.2007. [sonstige Veröffentlichung] Volltext nicht online.

  Krajewski, E. (1994) Leistungsanalyse von Staustrahlantrieben mit Ueberschallverbrennung. DGLR-Jahrestagung 1993, Göttingen, Oktober 1993. Volltext nicht online.

  Krajewski, E. und Kremer, F. und Winterfeld, G. (1993) Untersuchungen zur Auslegung von SCRAMJET-Antrieben. DGLR-Jahrestagung, 1993, Goettingen. Volltext nicht online.

  Krajewski (Winterfeld), E. (1992) Leistungsanalyse von Staustrahlantrieben mit Ueberschallverbrennung im Machzahlbereich bon 5 bis 15. DLR-Interner Bericht. 325-10-92, 178 S. Volltext nicht online.

  Kremer, F. (1990) Flugleistungsrechnungen für den Staustrahlantrieb eines Raumtransporters. Vortrag an der RWTH Aachen im Rahmen der Vortragsveranstaltung &quot;Ausgewählte Kapitel der Strahlantriebe&quot;, 18. Januar 1990, Aachen. Volltext nicht online.

  Kremer, F. (1990) Einfache Bahnoptimierungsbetrachtungen fuer Reise- und beschleunigte supersonische Flugpunkte mit Staustrahltriebwerken. DLR-Interner Bericht. 325-03-90, 54 S. Volltext nicht online.

  Kremer, F. (1990) Modellbeschreibung eines Ramjets. DLR-Interner Bericht. 325-09/90. Volltext nicht online.

  Kremer, F. (1993) Heat Addition in a Non-Constant Area Supersonic Combustor. AIAA/DGLR Fifth International Aerospace Planes and Hypersonics Technology Conference, 30.11.-03.12.93, Munich, Germany. Volltext nicht online.

  Kremer, F. (1994) Beschreibung von Ueberschallstaubrennkammerprozessen mittels eines eindimensionalen Modells. Seminar DLR-Lampoldshausen, 16.03.1994. Volltext nicht online.

  Kremer, F. (1993) Eindimensionale Brennkammerbetrachtungen fuer ein SCRAMJET. Gastvortrag im Rahmen der Vorlesung &quot;Ausgewaehlte Kapitel der Strahlantriebe&quot;, RWTH Aachen, 09.Feb. 1994. Volltext nicht online.

  Kremer, F. G. J. (1994) Leistungsanalyse von Stauantrieben fuer Hyperschallfluggeraete. Institutsüberprüfung SM-AT, 20.01.93, Köln-Porz. Volltext nicht online.

  Kremer, F. G. J. und Winterfeld, G. (1995) Leistungsanalyse von Dual-Mode-Scramjet-Antrieben für einstufige Raumtransporter im Bereich der Flugmachzahlen von 3,8 bis 13. DLR-Forschungsbericht. 95-47, 122 S. Volltext nicht online.

  Kremer, F.G.J. (1991) Momentenhaushalt und statische Längsstabilität eines hypersonischen FLugkörpers mit Staustrahltriebwerk mit Unterschallverbrennung. DLR-Interner Bericht. 325-11-91, 70 S. Volltext nicht online.

  Kremer, F.G.J. (1991) Flugmechanikmodell für Leistungsrechnungen und Wechselwirkungen zwischen Flugkörper und Staustrahltriebwerk mit Unterschallverbrennung in bezug zur Flugbahn. DLR-Forschungsbericht. 91-03, 94 S. Volltext nicht online.

  Kremer, F.G.J. (1991) Thermodynamische Strömungsbeschreibung eines Staustrahltriebwerks mit Unterschallverbrennung zur Bestimmung der Triebwerkskräfte und Momente. Dissertation. DLR-Forschungsbericht. 91-02, 155 S. Volltext nicht online.

  Kremer, F.G.J. (1994) Eindimensionale Brennkammerbetrachtungen für ein Scramjet. Gastvortrag im Rahmen der Vorlesung &quot;Ausgewählte Kapitel der Strahlantriebe&quot;, RWTH Aachen, 9. Februar 1994. Volltext nicht online.

  Kremer, F.G.J. (1994) Beschreibung von Überschallstaubrennkammerprozessen mittels eines eindimensionalen Modells. Seminarvortrag am 16.03.1994 in der DLR Lampoldshausen. Volltext nicht online.

  Kremer, F.G.J. (1994) System Analysis for Hypersonic Vehicles with Dual Mode Ram-Scramjet. Liepmann Ludwig Seminar, Caltech, USA, 14. Juni 1994.. Volltext nicht online.

  Kremer, F.G.J. (1994) Zur Auslegung von Flugkoerpern mit Scramjet-Antrieb. Promotionsvortrag RWTH Aachen, 22. April 1994.. Volltext nicht online.

  Kremer, F.G.J. (1994) Eindimensionale Brennkammerbetrachtungen fuer ein Staustrahltriebwerk mit Ueberschallverbrennung. Dissertation. DLR-Forschungsbericht. 94-06, 173 S. Volltext nicht online.

  Kruse, H. und Lecht, M. (1990) Gasturbinen-Entwicklungsperspektiven einer erprobten Technologie. In: Proceedings. ASUE. Turbo-KWK 90, Kraft-Waerme-Kupplung mit Gasturbinen. Int. Fachtagung der ASUE, 11.-12. Dezember 1990, Darmstadt. Volltext nicht online.

  Krüger, Franziska (2012) Entwicklung von parallelisierbaren Gradienten-basierten Verfahren zur automatisierten, Ersatzmodell-gestützten Optimierung unter Nebenbedingungen für CFD-FEM-Verdichterdesign. Masterarbeit, Technische Universität Berlin. file

  Kuegeler, E. und Weber, A. und Lisiewicz, S. (2001) Combination of a Transition Model with a Two-Equation Turbulence Model and Comparison with Experimental Results. In: Proceedings of the 4th European Conference on Turbomachinery, Seiten 877-887. ATI. Proceedings of the 4th European Conference on Turbomachinery, Florenz, Italy, 23.03.2001. ISBN 88-86281-57-9 Volltext nicht online.

  Kuesters, B. (1996) Numerische Untersuchung zweier KWU-Verdichtergitter mit dem Navier-Stokes-Verfahren TRACE. Vortrag bei Siemens AG/KWU in Muelheim/Ruhr, 02.07.1996. Volltext nicht online.

  Kuesters, B. (1997) 3D-Auslegung zweier transsonischer Rotoren. 2. Statusgespräch der Kooperation Siemens/DLR, Muelheim, 19.12.97. Volltext nicht online.

  Kämpf, K.-D. (1993) Numerische Berechnung und Analyse der Stroemung in einem Radialdichterrotor mit axialem Vorsatzlaeufer. sonstiger Bericht. Dipl.-Arbeit, Universität Bochum (RUB), April 1993, 129 S. Volltext nicht online.

  Kärcher, Bernd und Schumann, Ulrich und Brinkop, Sabine und Busen, Reinhold und Fiebig, Markus und Flentje, Harald und Gierens, Klaus und Graf, Jutta und Haag, Werner und Hendricks, Johannes und Mannstein, Hermann und Marquart, Susanne und Meyer, Richard und Minikin, Andreas und Petzold, Andreas und Ponater, Michael und Sausen, Robert und Schmid, Heidi und Wendling, Peter und Aigner, Manfred und Frank, Peter und Geigle, Klaus-Peter und Gerlinger, Peter und Noll, Berthold und Stricker, Winfried und Wahl, Claus und Schurath, U. und Möhler, O. und Schaefers, S. und Stetzer, O. und Schrems, O. und Beyerle, G. und Immler, F. und Kruse, H. und Döpelheuer, Andreas und Plohr, Martin und Schiller, C. und Bläsner, M. und Krämer, M. und Mangold, A. und Wollny, A. und Borrmann, S. und Curtius, J. und Henseler, S. und Hock, N. und Schneider, J. und Weimer, S. und Arnold, F. und Aufmhoff, H. und Gollinger, K. und Kiendler, A. und Stilp, Th. und Wilhelm, S. und Wohlfrom, K.H und Timmreck, C. und Feichter, J. und Lohmann, U. und Ström, J. und Rother, Tom (2004) Particles and Cirrus Clouds (PAZI) - Overview of Results 2000-2003. Projektbericht. 83, 197 S. Volltext nicht online.

  Köller, U. (1999) Entwicklung einer fortschrittlichen Profilsystematik für stationäre Gasturbinenverdichter. Dissertation. DLR-Forschungsbericht. 1999-20, 121 S. Volltext nicht online.

  Köller, U. und Mönig, R. und Küsters, B. und Schreiber, H.-A. (1999) Development of Advanced Compressor Airfoils for Heavy-Duty Gas Turbines. Part I: Design and Optimization. In: ASME Paper 99-GT-95. International Gas Turbine and Aeroengine Congress, Indianapolis, 7.-10. June 1999. Volltext nicht online.

  Köller, U. und Mönig, R. und Küsters, B. und Schreiber, H.A. (2000) Development of Advanced Compressor Airfoils for Heavy-Duty Gas Turbines - Part I: Design and Optimization. ASME Journal of Turbomachinery, 122 (3), Seiten 397-405. Volltext nicht online.

  Kügeler, E. (2000) Numerische Untersuchung der Filmkühlung aus einer Reihe von Fan-Shaped Bohrungen auf der Saugseite einer Turbinenschaufel und Vergleich mit Experimenten. DGLR Jahrestagung 2000, Leipzig, 21.09.2000. Volltext nicht online.

  Kügeler, E. (2005) Numerisches Verfahren zur genauen Analyse der Kühleffektivität filmgekühlter Turbinenschaufeln. Dissertation. DLR-Forschungsbericht. 11, 130 S. Volltext nicht online.

  Kügeler, E. und Nürnberger, D. (2004) TRACE User's Manual - Version 2.2. DLR-Interner Bericht. 325-07-04, 78 S. Volltext nicht online.

  Kühner, C. (1997) Entwurf von rotierenden Kühlkanälen in Gasturbinenschaufeln auf Basis numerischer Analyse der Strömung und Druckverluste. DLR-Interner Bericht. 325-08-97, 108 S. Volltext nicht online.

  Küsters, B. und Schreiber, H. A. und Steinert, W. (1996) Experimentelle und theoretische Untersuchungen des Verdichtergitters KWU-HPA 28/08. DLR-Interner Bericht. 325-06-96, 199 S. Volltext nicht online.

  Küsters, B. und Schreiber, H.-A. (1998) Compressor Cascade flow with Strong Shock/Wave/Boundary-Layer Interaction. AIAA Journal, 36 (11), Seiten 2072-2078. Volltext nicht online.

  Küsters, B. und Schreiber, H.-A. und Köller, U. und Mönig, R. (1999) Development of Advanced Compressor Airfoils for Heavy-Duty Gas Turbines. Part II: Experimental and Theoretical Analysis. In: ASME Paper 99-GT-96. International Gas Turbine and Aeroengine Congress, Indianapolis, 7.-10. June 1999. Volltext nicht online.

  Küsters, B. und Schreiber, H.-A. und Steinert, W. (1998) Experimentelle und numerische Untersuchung des Gasturbinen-Verdichtergitters KWU-HPA-26/070. DLR-Interner Bericht. 325-06-98. Volltext nicht online.

  Küsters, B. und Schreiber, H.A. und Köller, U. und Mönig, R. (2000) Development of Advanced Compressor Airfoils for Heavy-Duty Gas Turbines - Part II: Experimental and Theoretical Analysis. ASME Journal of Turbomachinery, 122 (3), Seiten 406-414. Volltext nicht online.

  Küsters, B. und Steinert, W. und Schreiber, H. A. (1996) Experimentelle und theoretische Untersuchungen des Verdichtergitters KWU-HPA 17/06. DLR-Interner Bericht. 325-07-96, 203 S. Volltext nicht online.

  Kügeler, Edmund und Geiser, Georg und Wellner, Jens und Weber, Anton und Moors, Anselm (2018) On the Simulation of unsteady Turbulence and Transition Effects in a Multistage Low Pressure Turbine, Part III: Comparison of Harmonic Balance and Full Wheel Simulation. In: Proceedings of the ASME Turbo Expo. ASME 2018 Turbo Expo, 11.-15.Juni 2018, Oslo, Norwegen. Volltext nicht online.


  Langer, R. (1993) Auslegung eines ebenen transsonischen Verdichterschnittes mit hoher Umlenkung. DLR-Interner Bericht. 325-03-93, 96 S. Volltext nicht online.

  Langowsky, C. (1992) AG-Turbo Halbjahresberichte II/1992-Teilverbundprojekt Turbotech. Projektbericht, DLR-Interner Bericht. Volltext nicht online.

  Langowsky, C. (1996) The Influence of Film Cooling on the Secondary Flow in a Turbine Nozzle. Fachvortrag ABB-Baden, SChweiz, 29.11.1996. Volltext nicht online.

  Langowsky, C. (1996) The Interaction between Secondary Flow and Film Cooling in a Turbine Nozzle. ICAS paper 96-6.10.1, Sorrento, Italien, 9.-12.9.1996. Volltext nicht online.

  Langowsky, C. (1996) Test Case 'Subsonic Low Aspect Ratio Turbine Nozzle'. AGARD Working Group 26. Volltext nicht online.

  Langowsky, C. (1996) Aerodynamic Losses in a Film Cooled Turbine Nozzle with Varied Blowing Ratios-An Experimental Investigation. Proceedings ISAIF, Peking, China, 1.-6.9.1996. Volltext nicht online.

  Langowsky, C. (1997) Wechselwirkung von Sekundaerstroemung und Kuehlluft in filmgekuehlten Turbinenstatoren. Dissertation. DLR-Forschungsbericht. 97-50, 115 S. Volltext nicht online.

  Langowsky, C. (1997) Experimentelle Analyse der Sekundaerstroemung in Turbinen mit Kuehlluftausblasung. Projektbericht, DLR-Interner Bericht. Abschlußbericht AG Turbo, Turbotech I, Vorhaben, 120 S. Volltext nicht online.

  Langowsky, C. und Vogel, D. T. (1995) The Influence of Film Cooling on the Secondary Flow in a Turbine Stator - An Experimental and Numerical Investigation -. In: AIAA paper 95-3040,San Diego, CA, USA. c by American Inst. of Aeronautics and Astronautics, Washington D.C. Volltext nicht online.

  Langowsky, C. und Vogel, D.T. (1996) Influence of Film Cooling on the Secondary Flow in a Turbine Nozzle. A publication of the AIAA, Inc., 1801 Alexander Bell Drive, Suite 500. AIAA Journal, Volume 35, NUMBER 1. Volltext nicht online.

  Langowsky, C. und Vogel, D.T. (1996) Influence of Film Cooling on the Secondary Flow in a Turbine Nozzle. AIAA Journal, 35, Seiten 111-118. Volltext nicht online.

  Langowsky, C. und Voigt, P. (1994) Film Cooling of an Annular Turbine Stator - Visualisation of Ccoling Air Ejection and its Effects on the Aerodynamic Losses. 12th Symposium on Measuring Techniques for Transonic and Supersonic Flow in Cascade and Turbomachines, Prague, Sept. 1994, Czech. Rep.. Volltext nicht online.

  Lauer, G. und Habisreuther, P. und Leuckel, W. und Eickhoff, H. (1996) Experimentelle Überprüfung eines JPDF-Reaktionsmodells. Gaswärme International, 45. Volltext nicht online.

  Lawrenz, K. (1990) Stroemungssichtbarmachung im rotierenden Kanal. DLR-Interner Bericht. 325-05-90, 109 S. Volltext nicht online.

  Lawrenz, K. (1991) Strömungsmessung mit Hilfe eines Laser-Anemometers in einem zylindrischen Modellkanal. DLR-Interner Bericht. 325-01-91, 105 S. Volltext nicht online.

  Lecheler. S., und Schnell, R. und Stubert, B. (2001) Experimental and Numerical Investigation of the Flow in a 5-Stage Transonic Compressor Rig. ASME Turbo-Expo 2001, 4.-7. Juni 2001, New Orleans/U.S.. Volltext nicht online.

  Lecht, A. und Deidewig, F. und Döpelheuer, A. und Schmitt, A. (1999) Entwicklung und Bewertung vereinfachter Verfahren zur Bestimmung von Abgasemissionen aus Flugtriebwerken im Reiseflug. Projektbericht. o.A., 64 S. Volltext nicht online.

  Lecht, M. (1998) Kyoto targets and technology aspects. 2nd Meeting of Expert Working Group on the Kyoto Follow Up in Aviation, Brüssel, 26. Jan. 1998, EC, DG VII, Transport. Volltext nicht online.

  Lecht, M. (1998) Considerations on the enhancement of emission certification from LTO to cruise and from engine to aircraft. ICAO/CAEP/WG3 (Emission Technical) First Meeting, Phoenix, USA, 15-16 December 1998. Volltext nicht online.

  Lecht, M. (1999) Comparison of DLR Fuel Flow Method and the P3-T3 Method for Cruise EINOX Prediction. ICAO/CAEP/WG3 Alternative Emissions Methodology Task Group, Boeing, Seattle, USA, 22/23 Sept. 1999. Volltext nicht online.

  Lecht, M. (1999) Comparison of AEDC Altitude Chamber Test Data and NOx Correlation based on Similarity of Engine Operation. ICAO/CAEP/WG3 Alternative Emissions Methodology Task Group, STNA, Toulouse, Frankreich, 27. April 1999. Volltext nicht online.

  Lecht, M. (2000) Effect of Aircraft Engine Bypass Ratio on NOx and CO2 Emissions. ICAO/CAEP/WG3 Alternative Emissions Methodology Task Group, 5th Meeting, 12-13 June, 2000, Cleveland, USA. Volltext nicht online.

  Lecht, M. (2001) Aspects of Aircraft Performance and NOx Emissions. ICAO/CAEP/Working Group 3 - Alternate Emissions Methodology Task Group (AEMTG), 6th Meeting, 14-15 February, 2001, Toulouse. Volltext nicht online.

  Lecht, M. (2000) ICAO/CAEP/Working Group 3 Emissions-Technical Issues - Bericht aus den Arbeitsgruppen. Vortrag im Bundesministerium für Verkehr, Bauen- und Wohnungswesen, Bonn, 8.12.2000. Volltext nicht online.

  Lecht, M. (1990) Thermodynamic Considerations on Fan Engine Recuperative Heat Cycles. In: Proceedings; DGLR-Bericht 90-01 (1990).. European Propulsion Forum &quot;Future Civil Engines and the Protection of the Atmosphere&quot;, 3-5 April 1990, Koeln-Porz.. Volltext nicht online.

  Lecht, M. (1991) Potential of ultra high bypass fan engine heat cycle on the reduction of fuel consumption and NOx-Emission. In: Proceedings of the 10th ISABE. AIAA, 10th ISABE, Sept. 1991, Nottingham (UK), 01.-06.09.1991. Volltext nicht online.

  Lecht, M. (1994) Emissionen aus Flugtriebwerken - Auswirkungen und Reduzierungspotentiale -. Seminar der Bundesvereinigung gegen Fluglärm e.V., 12.03.93, Hannover. Volltext nicht online.

  Lecht, M. (1993) Effect of Inlet Pressure and Temperature i.e. Flight Conditions on Emissions. ICAO/CAEP/Working Group 3, Certification/Technology Subgroup 23.-26.02.93, Amsterdam. Volltext nicht online.

  Lecht, M. (1994) Considerations on Engine NOx-Emission Regulatory Values. ICAO/CAEP/WG 3, Certification/Technology Subgroup, 19.-22.10.93, Paris, France.. Volltext nicht online.

  Lecht, M. (1994) Schadstoffe des Luftverkehrs. DLR-Jahreshauptversammlung, Messe Köln, 19.11.93. Volltext nicht online.

  Lecht, M. (1994) Aircraft Emission - Flight Performance and Emission Correlation. ECAC/ANCAT, Emissions Inventory Database Group, 10. Feb. 1994, Dept. of Trade and Industry, London, UK. Volltext nicht online.

  Lecht, M. (1994) Thematik und Sachstand der Arbeiten in den technischen Arbeitsgruppenfuer Schadstoffemissionen aus dem Luftverkehr der ICAO/CAEP. Vortrag aus Anlass eines Industriegespraeches beim BMV, 30.08.94. Volltext nicht online.

  Lecht, M. (1996) Engine Modeling and NOx Correlation. Vortrag bei Pratt & Whitney, East Hartford, USA, 12 Sept. 1996. Volltext nicht online.

  Lecht, M. und Deidewig, F. (1994) Engine Specific NOx Emissions (SFCx El). ICAO/CAEP/WG3 Certification/Technology Subgroup 8.-11. March 1994, Seattle, USA. Volltext nicht online.

  Lecht, M. und Deidewig, F. (1994) NOx Emission Correlation for Varying Engine Inlet Conditions. ICAO/CAEP/WG3 Certification/Technology Subgroup 8.-11. March 1994, Seattle, USA. Volltext nicht online.

  Lecht, M. und Deidewig, F. (1994) Small Aeroengine Performance and Emission Correlation. Projektbericht, DLR-Interner Bericht. Volltext nicht online.

  Lecht, M. und Deidewig, F. und Dameris, M. und Schmitt, A. (1995) Bewertung der globalen Emissionen des zivilen Luftverkehrs als Grundlage für die Anwendung in Atmosphärenmodellen. Projektbericht, DLR-Interner Bericht. Volltext nicht online.

  Lecht, M. und Deidewig, F. und Döpelheuer, A. (1997) Aircraft Specific Exhaust Emissions. In: Pollutants from Air Traffic: Results of Atmospheric Research 1992-1997, Seiten 27-35. Pollutants from Air Traffic: Results of Atmospheric Research 1992-1997. Volltext nicht online.

  Lecht, M. und Deidewig, F. und Döpelheuer, A. (1998) Flugzeugspezifische Emissionen in &quot;Schadstoffe in der Luftfahrt&quot;. In: Schadstoffe in der Luftfahrt. Abschlußkolloquium des BMBF Verbundprogramms, Köln 31.03.1998. Volltext nicht online.

  Lecht, M. und Deidewig, F., Doepelheuer, A., und Schmitt, A. (FF-VL) (1997) Entwicklung und Bewertung vereinfachter Verfahren zur Bestimmung von Abgasemissionen aus Flugtriebwerken im Reiseflug. Projektbericht, DLR-Interner Bericht. Volltext nicht online.

  Lecht, M. und Döpelheuer, A. und Plohr, M. (2000) Entwicklung vereinfachter Methoden zur Abgaszertifizierung (NOx) von Triebwerken unter Flugbedingungen. Projektbericht, DLR-Interner Bericht. Zwischenbericht BMVBW L1/99-50158/98, 48 S. Volltext nicht online.

  Lecht, M. und Raede, M. und Schmitt, A. (1995) Emissionssituation im Luftverkehr. Seminar im Haus der Technik e.V., Essen am 28.11.1995. Volltext nicht online.

  Lecht, M. und Schmitt, A. (FF-VL) (1996) Die zeitliche Entwicklung der Verteilung der Luftverkehrsemissionen. Projektbericht, DLR-Interner Bericht. Zwischenbericht zum BMBF-Forschungsvorhaben Förderkennzeichen 01LL9502/0, 28 S. Volltext nicht online.

  Lecht, M. und Weyer, H.B. und Wurzel, D. (1994) Pollutants from Air Traffic, Effects and Prevention-A Cooperative Endeaver of Research Centers, Academia and Industry. In: Impact of Emissions from Aircraft and Spacecraft Upon the the Atmosphere. DLR. Impact of Emissions from Aircraft and Spacecraft Upon the the Atmosphere; Proc. of an Int. Sc. Colloquium,Koeln,18-20.4.94. Volltext nicht online.

  Lee, D.S. und Brunner. B., und Doepelheuer, A. und Falk, R.S. und Gardner, R.M. und Lecht, M. und Leech, M. und Lister, D.H. und Newton, P. (2002) Aviation emissions: present-day and future. Meteorologische Zeitschrift, 11 (3), Seiten 141-150. Volltext nicht online.

  Lehmann, B. (1997) Messungen im drallbehafteten isothermen Strömungsfeld hinter Zweistrom-Zerstäubungsdüsen mit Hilfe dreikomponentiger Transitionsvorgänge. Seminar für Strömungsmechanik, Hermann-Föttinger-Institut für Strömungsmechanik, TU Berlin, 30.5.1997. Volltext nicht online.

  Lehmann, B. und Barsikow, B. (1) (1996) Lichtschnittuntersuchungen der Instabilitaetsformen eines heissen Luft-Freistrahls. In: Proceedings 5. Fachtagung der GALA e.V. &quot;Lasermethoden in der Strömungsmeßtechnik (1996). 5. Fachtagung der GALA e.V. &quot;Lasermethoden in der Strömungsmeßtechnik &quot;, 11.-13.9.1996. Volltext nicht online.

  Lehmann, B. und Graichen, K. und Ruck, B. und Leder, A. und Dopheide, D. (1996) Lasermethoden in der Stroemungsmesstechnik. 5. Fachtagung der GALA e.V. In: Tagungsband der 5. GALA-Fachtagung, 11.-13. September 1996, TU Berlin.. Shaker-Verlag, Aachen 1996.. Volltext nicht online.

  Lehmann, B. und Hassa, C. und Helbig, J. (1996) Three-Component Laser-Doppler Measurements of the Confined Model Flow Behind a Swirl Nozzle. In: Proceedings 8th International Symposium on Applications of Laser Techniques to Fluid Mechanics (1996). 8th Int. Symp. on Applic. of Laser Techniques to Fluid Mechanics, 8-11 July 1996 Lissabon. Volltext nicht online.

  Lehmann, B. und Hassa, C. und Helbig, J. (1997) Three-component Laser-Doppler measurements of the confined model flow behind a swirl model. In: Development in Laser Techniques and Fluid Mechanics: Selected Papers from the 8th International Symposium , Lisbon, Portugal, 8-11 July 1996 (Hrsg.: R.J. Adrian, D.F.G. Durao, F. Durst, M.V. Heitor, M. Maeda, J.H. Whitelaw). Springer-Verlag, Berlin 1997. Volltext nicht online.

  Lehmann, B. und Mante, J. (1995) Schnelles Scannen eines Strömungsfeldes mit einer Laser-Doppler-Meßtechnik. DGLR-Fachausschußsitzung &quot;Flächige Strömungsmeßverfahren&quot;, Berlin, 2.-3. März 1995. Volltext nicht online.

  Lehmann, B. und Mante, J. (1996) Eigenschaften, Probleme und Entwicklungspotential der Laser-Doppler-Scanning-Methode zur schnellen Erfassung von Geschwindigkeitsprofilen. In: Proceedings LIF 8 (1996) 8 S., 10 Bild., 3 Lit.. LIF 8, Köln, 18.-19. 6. 1996. Volltext nicht online.

  Lehmann, B. und Mante, J. und Helbig, J. (1996) Dreikomponenten-LDA-Messungen in einer vorgemischten Stauflamme. In: Proceedings 5. Fachtagung der GALA e.V. &quot;Lasermethoden in der Strömungsmeßtechnik&quot; (1996). 5. Fachtagung der GALA e.V., TU Berlin, 11.-13.9.1996. Volltext nicht online.

  Leicht, Tobias und Bleh, Alexander und Braun, Sebastian und Einarsson, Gunnar und Flamarique Ederra, Imanol und Hartmann, Ralf und Holke, Johannes und Jägersküpper, Jens und Klitz, Margrit und Orlt, Matthias und Rempke, Arne und Rüttgers, Alexander und Schwöppe, Axel und Spiering, Frank und Vollmer, Daniel (2018) Towards a Unified Platform for Massively Parallel Numerical Flow Simulation. Deutscher Luft- und Raumfahrtkongress 2018, 04.-06. Sept. 2018, Friedrichshafen. (nicht veröffentlicht) Volltext nicht online.

  Lempereur, Christine und Barricau, Philippe und Gleyzes, Christian und Willert, Christian und Stockhausen, Guido und Klinner, Joachim (2006) Mise en oeuvre et validation de la velocimetrie Doppler globale en soufflerie. Congrès Francophone de Techniques Laser (CFTL 2006), 2006-09-19 - 2006-09-22, Toulouse (France). Volltext nicht online.

  Lempereur, Christine und Barricau, Philippe und Gleyzes, Christian und Willert, Christian und Stockhausen, Guido und Klinner, Joachim (2006) Doppler global velocimetry in wind tunnels - implementation issues and performance analysis. 13th International Symposium on Applications of Laser Techniques to Fluid Mechanics, 2006-06-26 - 2006-06-29, Lissabon (Portugal). Volltext nicht frei. filefile

  Lengyel-Kampmann, Timea und Voß, Christian und Nicke, Eberhard und Rüd, Klaus-Peter und Schaber, Reinhold (2014) Generalized optimization of counter-rotating and single-rotating fans. ASME2014, 16-20. June 2014, Düsseldorf, Germany. Volltext nicht online.

  Lenze, M. (1994) Experimentelle Untersuchungen zum Fett-Mager-Verbrennungskonzept bei triebwerksspezifischen Randbedingungen. sonstiger Bericht. Volltext nicht online.

  Lisiewicz, S. (1996) Numerical Analysis of the DLR Turbine Stator VT1B. AGARD WG 26, Meeting in Athen, 1996. Volltext nicht online.

  Liu, J. M. (1) und Holste, F. und Neise, W. (1996) On the azimuthal mode structure of rotating blade flow instabilities in axial turbomachines. In: Proc. 2nd AIAA/CEAS Aeroacoustics Conference (1996). 2nd AIAA/CEAS Aeroacoustics Conference (17th AIAA Aeroacoustics Conference), May 6-8, 1996, Penn State University, State College, Penns., USA. Volltext nicht online.

  Lynn, T. B. und Bechert, D. W. und Gerich, D. A. (1995) Direct Drag Measurements in a Turbulent Flat Plate Boundary Layer with Turbulence Manipulators. Experiments in Fluids, Vol. 19, Seiten 404-415. Volltext nicht online.


  Maass, M. (1995) Druckmessungen mit Halbleiter-Miniatursonden. Volltext nicht online.

  Maass, M. (1995) Kalibrierung von Halbleiter-Drucksonden. DLR-Mitteilung. 95-03. Volltext nicht online.

  Maass, M. (1995) Laser Measurements in Ducted Propfan Blade Wakes. 31st AIAA/ASME/SAE/ASEE Joint Propulsion Conference, July, 10-12, 1995, San Diego, CA, USA. Volltext nicht online.

  Maass, Martin (1993) Temperature Error Compensation of a Miniature Semiconductor Pressure Transducer and First Results of Measurements Taken in a Ducted Propfan Rotor. Measuring Techniques for Transsonic and Supersonic Flow in Cascades a nd Turbomaschines/Proceed. of the 11th Sympos. 14.-15.09.92, Muenchen. Volltext nicht online.

  Maass, M., Foerster, W., und Thiele, P. (1994) Unsteady Flow Experiments in the Exit of a Ducted Propfan Rotor. In: 30th AIAA/ASME/SAE/ASEE Joint Propulsion Conference, 27.-29. June 199 4, Indianapolis, USA.. Volltext nicht online.

  Maaß, M. (1996) Analyse der räumlichen Strömung im Austritt eines Propfans. Dissertation. DLR-Forschungsbericht. 96-07, 119 S. Volltext nicht online.

  Magens, E. (1992) Entwicklung eines eigenen Rechenverfahrens zur Simulation von H2O-CARS Spektren bei hohen Temperaturen. LIF 5, 27.-28.01.92, Lampoldhausen . Volltext nicht online.

  Magens, E. (1992) Simulation of H2O-Spectre. Meeting HERMES diagnostic group, 24.02.1992, Köln-Porz. Volltext nicht online.

  Magens, E. und Leipertz, A. (1992) Evaluation of accumulated rotational CARS spectre taken in mixing regions of flames. XI'th CARS-Workshop, 23.-25.02.1992, Florenz, Italy. Volltext nicht online.

  Marnett, M. (2004) Numerische Simulation der Kühlluftströmung in einem verrippten Multipass-Kühlsystem einer Turbinenschaufel. DLR-Interner Bericht. 325-14-04, 113 S. Volltext nicht online.

  Martin, B. (2004) Experimentelle Studien zur wandnahen, kompressiblen Strömung in Verdichtergittern. Diplomarbeit. DLR-Interner Bericht. DLR-IB 325 - 10 - 04, 157 S. Volltext nicht online.

  Martin, Seifert und Guido, Stockhausen und Richard, Schodl und Willert, Christian (2007) Untersuchung möglicher Fehlerquellen bei der Konzentrationsmessung mittels des Quantitativen Lichtschnittverfahrens (QLS). DLR-Interner Bericht. DLR-IB 325-20-07, 18 S. Volltext nicht online.

  Matha, Marcel und Morsbach, Christian und Bergmann, Michael (2018) A comparison of methods for introducing synthetic turbulence. In: ECCOMAS - - ECFD 2018 - 6th European Conference on Computational Mechanics (Solids, Structures and Coupled Problems) / 7th European Conference on Computational Fluid Dynamics. ECCOMAS ECCM ECFD, 11. - 15. Juni 2018, Glasgow. file

  Matthiä, Daniel und Schaefer, Martin und Meier, Matthias M. (2015) Economic impact and effectiveness of radiation protection measures in aviation during a ground level enhancement. Journal of Space Weather and Space Climate, 5, A17. EDP Sciences. DOI: 10.1051/swsc/2015014 ISSN 2115-7251 file

  Meier, U.E. und Stricker, W. und Wolff-Gassmann, D. und Heinze, J. (2002) Planare Temperaturmessung am OH mittels LIF in technischen Verbrennungssystemen. Gaswärme international, 51 (4), Seiten 178-183. Volltext nicht online.

  Meislitzer, B. und Pommerening, S. und Stursberg, K. (1994) Korrekturerfordernisse bei Thermoelementenmessungen in Flammen. DLR-Interner Bericht. 325-14-94, 122 S. Volltext nicht online.

  Melake, A. (1991) Isoparametric Finite Element Approach to Particle Trajectory: Applied as an Analysis Tool to CRISP Aerodynamics. DLR-Forschungsbericht. 91-40, 89 S. Volltext nicht online.

  Melake, A. (1996) Numerische Simulation der Strömung im radialen Schaufelspalt axialer Turbomaschinen. Dissertation. DLR-Forschungsbericht. 96-06, 125 S. Volltext nicht online.

  Melake, A. (1996) Differentialtopologische Analyse der singulaeren Punkte in der Stroemungsmechanik. DLR-Interner Bericht. 325-01-96. Volltext nicht online.

  Melake, A. (1997) Three-dimensional Navier-Stokes Analysis of Tip Clearance Flow in an Annular Compressor Cascade. 33rd AIAA/ASME/SAE/ASEE Joint Propulsion Conference & Exhibit, 6-9 July, 1997, Seattle, USA. Volltext nicht online.

  Mercier, T. (2003) Calibration of a Hot Wire Probe and turbulence measurements. DLR-Interner Bericht. 225-2003 A 01, 35 S. Volltext nicht online.

  Merenda, T. und Röber, T. (2004) Berücksichtigung von Wandrauhigkeit in einem RANS-basierten CFD-Verfahren für Turbomaschinenströmungen. Diplomarbeit. DLR-Interner Bericht. 325-12-04, 52 S. Volltext nicht online.

  Metzinger, H. (1991) Untersuchung zur Eigenerwärmung von NTC-Thermistoren. DLR-Interner Bericht. 325-09-91, 23 S. Volltext nicht online.

  Meyer, R. und Bechert, D. W. und Hage, W. (1996) Separation control on a glider wing with artificial bird feathers. In: Proceedings Advances in Turbulence VI, Seiten 471-472. Kluwer, Dordrecht. 6th European Turbulence Conference, Lausanne, 2-5 July 1996. Volltext nicht online.

  Meyer, R. und Bechert, D. W. und Hage, W. (1996) Artificial birds feathers as a lift-enhancing device on airfoils. XIXth International Congress of Theoretical and Applied Mechanics, Kyoto, Japan, 25-31 August 1996. Volltext nicht online.

  Meyer, R. und Bechert, D. W. und Hage, W. und Patone, G. (1995) Rückstrombremse nach dem Vorbild der Vogel-Deckfedern. Seminar &quot;Bionik, Evolutionsstrategie, neuronale Netze, TU Berlin, 1. Dezember 1995. Volltext nicht online.

  Meyer, R. und Bechert, D.W. und Hage, W. (1997) Experiments with the artificial bird feathers for separation control on airfoils. Euromech Colloquium 361, &quot;Active Control of Turbulent Shear Flows&quot; and Final Colloquium of DFG Research Group Control of Turbulent Shear Flows, März 1997, TU Berlin. Volltext nicht online.

  Meyer, R. und Bechert, D.W. und Hage, W. (1997) Wind tunnel and flight experiments with artificial bird feathers for separation control on airfoils. Euromech 3rd European Fluid Mechanics Conference 1997, September 1997, Göttingen. Volltext nicht online.

  Meyer, R. und Bechert, D.W. und Hage, W. und Montag, P. (1997) Aeroflexible Oberflächenklappen als &quot;Rückstrombremsen&quot; - nach dem Vorbild der Deckfedern des Vogelflügels. DLR-Interner Bericht. 92517-97/B5, 55 S. Volltext nicht online.

  Meyer, R. und Bechert, D.W. und Hage, W. und Montag, P. (1997) Aeroflexible Oberflächenklappen als Rückstrombremsen (nach dem Vorbild der Vogeldeckfedern). Symposium für Segelflugzeugentwicklung, Stuttgart, Volltext nicht online.

  Michel, U. (1995) Broadband Shock Noise: Theory vis-a-vis Experimental Results. In: Proc. First CEAS/AIAA Aeroacoustics Conference. DGLR-Bericht 95-01 (1995), Seiten 545-554. First CEAS/AIAA Aeroacoustics Conference (16th AIEAA Aeroacoust. Conference), Munich, 12-15 June 1995. Volltext nicht online.

  Michel, U. (1995) Aerodynamic Sound Generation of Wind Turbines. In: Proceedings ERCOFTAC-Workshop (1995), Seiten 26-33. ERCOFTAC-Workshop, Dresden, 28-29 September 1995. Volltext nicht online.

  Michel, U. (1995) Turbulenzmodellierung in Stroemungen mit Verbrennung. ABB-DLR-Workshop, Baden/Schweiz, 20.10.1995. Volltext nicht online.

  Michel, U. (1995) Turbulence in Windtunnels. Seminar, Tel Aviv University, Israel, 9 May 1995. Volltext nicht online.

  Michel, U. (1995) Sound Generation by Aircraft. DLR-Interner Bericht. 92517-95/B5, 89 S. Volltext nicht online.

  Michel, U. (1997) Feasibility study on the use of two-dimensional microphone arrays in the DNW. DLR-Interner Bericht. 92517-97/B2, 41 S. Volltext nicht online.

  Michel, U. (1997) Investigation of moving sound sources with planar microphone arrays. DLR-Interner Bericht. 92517-97/B3, 12 S. Volltext nicht online.

  Michel, U. (1997) Investigation on noise sources in high.speed flight with a microphone array. Beijing University of Aeronautics and Astronautics, Beijing, VR China, 21.10.97. Volltext nicht online.

  Michel, U. (1997) The theory of flight effects on jet mixing noise and broadband shock noise. Beijing University of Aeronautics and Astronautics, Beijing, VR China, 24.10.97 / Northwestern Polytechnical University, Xi'an, Shaanxi, VR China, 28.10.97. Volltext nicht online.

  Michel, U. und Barsikow, B. und Haverich, B. und Schüttpelz, M. (1997) Investigation of airframe and jet noise in high-speed flight with a microphone array. 3rd AIAA/CEAS Aeroacoustics Conference, May 1997, Atlanta, Georgia, USA; Paper No. 97-1596. Volltext nicht online.

  Migueis, C. (1994) Experimentelle und numerische Untersuchung zur Optimierung des Mischmoduls einer fett-mager-gestuften Brennkammer. Vortrag im Institut fuer Antriebstechnik, DLR, Koeln-Porz, 12.09.94. Volltext nicht online.

  Migueis, C.E. (1995) Experimentelle und numerische Untersuchung zur Optimierung des Mischmoduls einer fett-mager-gestuften Brennkammer. MTU München, 04.04.1995, München. Volltext nicht online.

  Migueis, C.E. (1996) Untersuchungen zur Optimierung der Mischzone einer fett-mager gestuften Ringbrennkammer. Kolloquium Energietechnik, Ruhr-Universitaet Bochum, 14.02.1996. Volltext nicht online.

  Migueis, C.E. (1996) Untersuchungen zur Optimierung der Mischzone einer fett-mager gestuften Ringbrennkammer. Dissertation. DLR-Forschungsbericht. 96-33, 99 S. Volltext nicht online.

  Migueis, C.E. und Hassa, C. (1995) Experimentelle und numerische Untersuchung zur Optimierung des Mischmoduls einer fett-mager gestuften Brennkammer. 17. Deutscher Flammentag, 12./13. Sept. 1995, TU Hamburg-Harburg. Volltext nicht online.

  Moreau, Antoine und Le Denmat, Anne-Laure und Guerin, Sebastien (2011) Design of the new NWB Ventilator : an Acoustic and Aerodynamic Study. DLR-Interner Bericht, Projektbericht. DLR-IB 92517-11/B6, 88 S. Volltext nicht online.

  Morsbach, Christian und Schlüß, Daniel und Franke, Martin und Doll, Ulrich und Burow, Eike und Beversdorff, Manfred und Stockhausen, Guido und Willert, Christian (2015) The flow field inside a Ranque-Hilsch vortex tube part II: Turbulence modelling and numerical simulation. Ninth International Symposium on Turbulence Shear Flow Phenomena (TSFP-9), 30. Jun. - 03. Jul. 2015, Melbourne, Australien. Volltext nicht online.

  Muehleck, P. (1994) Numerische Loesung der Navier-Stokes Gleichungen in der Lagrange Formulierung zur Berechnung reagierender Stroemungen. Seminarvortrag am Inst. f. Thermo- und Fluiddynamik, Universitaet Bochum, 12.12.1994. Volltext nicht online.

  Muehleck, P. und Schuetz, H. (1992) Numerische Untersuchungen von Brennkammer-Duesenstroemungen bei Staustrahltriebwerken. In: Proceedings des 8. TECFLAM Seminars: Modellierung technischer Flammen, Seiten 53-65. AGARD Paris. 13. November 1992 Darmstadt. Volltext nicht online.

  Muehleck, P. und Schuetz, H. (1993) 3D-Numerical Simulation of Combustion Chamber and Nozzle Flow Including NOx-Formation. Space Course 1993, TU Muenchen, 11.-22.Okt. 1993. Volltext nicht online.

  Muehleck, P. und Schuetz, H. (1993) Numerical Study of Nitric Oxide Formation in a Hypersonic Ramjet Engine. In: 11th ISABE, 11.-22.09.93, Tokio, Seiten 1275-1283. Volltext nicht online.

  Muehleck, P. und Stursberg, K. (1993) Fliegen bei Mach 7. DLR-Nachrichten Nr. 73, 1993Der Hyperschallantrieb auf dem Pruefstand, Seiten 41-47. Volltext nicht online.

  Muehleck, R. und Schuetz, H. und Kremer, F. (1991) Influence of the flight trajectory on the exhaust gas composition of a H2-fueled air-breathing ramjet engine. In: Proceedings: Lecture Notes in Engineering. Springer, Heidelberg. 3rd Aerospace Symposium, Braunschweig, 26.-28.08.91. Volltext nicht online.

  Muller, J.-S. (2001) Kalibration einer Einlochzylindersonde im Unterschallbereich. Diplomarbeit. DLR-Interner Bericht. 225-2001 A 01, 40 S. Volltext nicht online.

  Munson, Matthew und Willert, Christian und Gharib, Morteza (2009) Real-time PIV for Active Flow Control Applications. 62nd Annual Meeting of the APS Division of Fluid Dynamics, 22.-24. Nov. 2009, Minneapolis, MN, USA. Volltext nicht online.

  Munzinger, C. (1997) Untersuchung des Emissionsverhaltens von PTL-Triebwerken bei vorgegebener Flugmission. DLR-Interner Bericht. 325-10-97, 114 S. Volltext nicht online.

  März, J. und Herrmann, M. und Neise, W. (1997) Instrumentierung von Schaufeln des Niedergeschwindigkeitsverdichters der TU Dresden mit Drucksensoren. (Technische Informationen). DLR-Interner Bericht. 92517-97/B8, 53 S. Volltext nicht online.

  Mönig, Reinhard (2008) Sparsame, leise und emissionsarme Flugzeuge - Wunschtraum oder bald Realität? In: Fünfzehntes Kolloquium Luftverkehr an der Technischen Universität Darmstadt: August-Euler-Luftfahrtpreis Verleihung. Nachhaltiges Wachstum im Luftverkehr - leise, sauber, energieeffizient Kolloquium Luftverkehr, 15. TU Darmstadt. Seiten 60-74. ISBN 978-3-931385-17-0. Volltext nicht online.

  Mönig, Reinhard (2011) Technologien für die Flugantriebe von morgen. 2. Energiesymposium an der Akademie der Wissenschaft und der Literatur Mainz, 25. Februar 2011, Mainz, Deutschland. (nicht veröffentlicht) Volltext nicht online.

  Mönig, Reinhard (2011) Entwicklungstendenzen von Turbokomonenten für Flugantriebe und Gasturbinen der nächsten Generation. Festkolloquium zu Ehren Prof. Dr.ès sc. techn. (EPFL) Horst Stoff, Ruhr-Universität Bochum, 11. Juli 2011, Bochum, Deutschland. (nicht veröffentlicht) Volltext nicht online.

  Mühleck, P. (1995) Numerische Untersuchung turbulenter, reagierender Strömungen in Brennkammern und Schubdüsen von Hyperschall-Staustrahltriebwerken. Dissertation. DLR-Forschungsbericht. 95-18, 127 S. Volltext nicht online.

  Mühleck, P. und Schütz, H. (1991) Einfluß der Flugbahn auf die Abgaszusammensetzung bei einem Turbo/ Staustrahlantrieb mit Wasserstoff als Brennstoff. DGLR-Fachausschußsitzung &quot;Technologien + Synergien bei Antrieben für 2stufige, horizontalstartende Raumtransporter&quot;, Ottobrunn, 21.-22.12.1991. Volltext nicht online.

  Mühleck, P. und Stursberg, K. (1994) Numerische Simulation turbulenter Verbrennungsvorgaenge und ihre experimentelle Überprüfung an einer Hyperschall-Brennkammer. In: Tagungsband Deutscher Luft- und Raumfahrtkongreß 1994, Jahrbuch der DGLR 1994. Volltext nicht online.

  Müller, G. (1999) Entwicklung einer lernfähigen Steuerung zur Nachführung einer Gesichtsfeldblende synchron zur Laserablenkung in einem Doppler-Global Velocimeter Messsystem. DLR-Interner Bericht. 325-02-99, 88 S. Volltext nicht online.

  Mößner, Steffen (2009) Verwendung von Leistungs-Lumineszenzdioden (LED) in der Strömungsmesstechnik. Diplomarbeit, Fachhochschule Köln. file


  Nannen, H. (1996) Experimentelle Untersuchungen eines atmosphaerischen Fett-Mager-Brennkammersektors mit zweireihiger Anordnung der Luftstrom-Zerstaeuberduesen. Diplomarbeit. DLR-Interner Bericht. Diplomarbeit Universität Karlsruhe, März 1996, 50 S. Volltext nicht online.

  Neise, W. (1995) Sound Power Measurement Procedures for Fans. Acta Acustica, 3, Seiten 473-485. Volltext nicht online.

  Neise, W. (1995) Akustische Modellgesetze zur Beschreibung und Prognose von Ventilatorgeraeuschpegeln und -spektren basierend auf Modellmessungen. Sitzung FLT-Arbeitsgruppe Ventilatoren des Arbeitskreises 1 Lufttechnik, Braunschweig, 27. Juni 1995. Volltext nicht online.

  Neise, W. (1995) Entstehungsursachen tieffrequenter Druckschwankungen bei Ventilatoren. Sitzung FLT-Arbeitsgruppe Ventilatoren des Arbeitskreises 1 Lufttechnik, Braunschweig, 27. Juni 1995.. Volltext nicht online.

  Neise, W. (1995) Research on Propfan Noise and on Rotating Flow Instabilities in Axial Flow Machines. ABB-DLR Workshop, Baden/Schweiz, 20 October 1995. Volltext nicht online.

  Neise, W. (1995) Tip Clearance Noise and Rotating Instabilities in Axial Flow Machines. ONERA-DLR Workshop at CERT, Toulouse/France, 13 November 1995. Volltext nicht online.

  Neise, W. (1996) Geraeuschmessverfahren fuer Ventilatoren. In: VDI-Bericht 1249 (1996) 27-41. VDI-GET-Tagung &quot;Ventilatoren im industriellen Einsatz III&quot;, Braunschweig, 28.-29.2.1996. Volltext nicht online.

  Neise, W. (1996) Research at the DLR-Institut für Antriebstechnik, Abteilung Turbulenzforschung Berlin. Spring Workshop Center of Acoustics and Vibration, Penn State University, Pennsylvania, USA. Volltext nicht online.

  Neise, W. (1997) Lärmminderung an einem Akustik-Windkanal - kleine Ursache, große Wirkung. Seminar für Strömungsmechanik, Herrmann-Föttinger-Institut für Strömungsmechanik, TU Berlin, 31.1.97. Volltext nicht online.

  Neise, W. (1997) Research at the DLR-Institut fuer Antriebstechnik, Abteilung Turbulenzforschung Berlin (DLR-Institute for Propulsion Technique, Turbulence Research Division Berlin). Beijing University of Aeronautics and Astronautics, Beijing, VR China, 24.10.97 / Northwestern Polytechnical University, Xi'an, Shaanxi, VR China, 27.10.97. Volltext nicht online.

  Neise, W. (1997) Influence of blade number and tip clearance on tip clearance noise and rotating blade flow instability of axial turbomachines. Beijing University of Aeronautics and Astronautics, Beijing, VR China, 21.10.97 / Northwestern Polytechnical University, XI'an, Shaanxi, VR China, 27.10.97. Volltext nicht online.

  Neise, W. (1997) Blade tip cavity noise of a large axial-flow wind-tunnel fan. Beijing University of Aeronautics and Astronautics, Beijing, VR China, 24.10.97 / Northwestern Polytechnical University, Xi'an, Shaanxi, VR China, 28.10.97. Volltext nicht online.

  Neise, W. und Bartenwerfer, M. (1995) Akustische Modellgesetze zur Beschreibung und Prognose von Ventilatorgeraeuschpegeln und -spektren basierend auf Modellmessungen. DLR-Interner Bericht. Forschungsvereinigung für Luft- und Trocknungstechnik e.V., Frankfurt am Main, FLT 3/1/33/95, 69 S. Volltext nicht online.

  Neise, W. und Dobrzynski, W. und Isermann, U. und König, R. und Claßen, A. B. und Bischoff, G. (2009) Strategien zur Lärmminderung an der Quelle unter Einschluss operationeller Möglichkeiten, speziell für den Nachtflug. DLR-Interner Bericht, Projektbericht. DLR-IB-92517/B5. Volltext nicht online.

  Neise, W. und Holste, F. und Miranda, L. und Herrmann, M. (1995) Free-field Sound Power Levels of Open-inlet/Open-outlet Fans and Comparison with In-duct Measurements. Noise Control Engineering Journal, 43, Seiten 129-143. Volltext nicht online.

  Neise, W. und Schulz, J. und Kaplan, B. (2004) Minderung des Triebwerkslärms. Ignition September 2004, Ignition, Seiten 46-49. Volltext nicht online.

  Neise, W. und Wurzel, D. (2007) Weniger Lärm trotz mehr Verkehr. In: Haus der Technik. Tagung Fahrzeugaußengeräusche, 2007-01-30 - 2007-01-31, Essen. Volltext nicht online.

  Neise, W. und v. Heesen, W. (1) und Lindener, N. (2) und Hansen, J. (1) (1996) Blade tip cavity noise of a large axial-flow wind tunnel fan. In: Proc. 2nd AIAA/CEAS Aeroacoustics Conference (1996). 2nd AIAA/CEAS Aeroacoustics Conference (17th AIAA Aeroacoustics Conference), May 6-8, 1996, Penn State University, State College, Penns., USA. Volltext nicht online.

  Nicke, E. (1996) Navier-Stokes-Nachrechnung eines transsonischen Fanrotors und Vorstellungen zu neuen Rotorkonzepten. DASA, MTU Muenchen, BRD. Beratung zum Stand der DLR/MTU-Kooperation &quot;Wehrtechnisches Technologieprogramm Niederdruckverdichter&quot;, 6.08.1996, MTU, Muenchen. Volltext nicht online.

  Nicke, E. (1996) Auslegung und Nachrechnung eines Rotors mit &quot;Precompression&quot;-Profilen. DLR, Institut fuer Antriebstechnik, Koeln-Porz, BRD. Statusseminar ueber die MTU/DLR-Kooperation &quot;Gemeinsam zur neuen Triebwerkstechnik&quot;, 26.-27.3.96, Koeln-Porz. Volltext nicht online.

  Nicke, E. (1997) Abschätzung von Kennfeldern für einen transsonischen zweistufigen Axialverdichter mit Theta=4,5. DLR-Interner Bericht. 325-07-97, 35 S. Volltext nicht online.

  Nicke, E. und Hausmann, J. und Kemme, R. und Kocian, F. (2004) Multidisziplinärer Entwurf höchstbelasteter Verdichterstufen mit neuen Werkstoff- und Konstruktionskonzepten. Deutscher Luft- und Raumfahrtkongress 2004, Dresden, 23.-24.09.2004. Volltext nicht online.

  Nicke, E. und Hausmann, J. und Kocian, F. und Kemme, R. (2003) Von der Aerodynamik über die Struktur zur Aeroelastik - Integraler Entwurf höchstbelasteter Verdichterstufen. Ehrenkolloquium für Herr Prof. Winterfeld, Köln, Oktober 2003. Volltext nicht online.

  Nicke, E. und Steinert, W. und Weber, A. und Starken, H. (1993) Design and Analysis of a Highly Loaded Compressor Cascade. 82nd PEP-Sympsosium AGARD, &quot;Technology Requirments for Small Gas Turbines&quot;, 4.-8. Oct. 1993, Montreal, Canada. Volltext nicht online.

  Nicke, Eberhard und Nürnberger, Dirk (2002) Potential of 3D Flow Simulation for Multistage Turbomachinery Design. ODAS Onerea-DLR Aerospace Symposium, 2002-06-13 - 2002-06-14, Köln. Volltext nicht online.

  Nicklas, M. (2001) Filmgekühlte Turbinenplattform in transsonischem Strömungsfeld. Dissertation. DLR-Forschungsbericht. 2000-10, 177 S. Volltext nicht online.

  Noll, B. und Kessler, R. und Lehmann, B. und Rachner, M. und Frank, P. und Schmitz, G. und Geigle, K.-P. und Meier, W. und Schütz, H. und Forkert, T. und Aigner, M. (2002) Ergebnisse des Projekts &quot;Brennkammermodellierung&quot; (BKM II). DLR-Forschungsbericht, Projektbericht. 2002-16, 83 S. Volltext nicht online.


  Ochrymiuk, T. (2003) Numerical Calculations of the Flow Field within a turbine cascade (Streamline 6). DLR-Interner Bericht. 225-2002 C 06, 34 S. Volltext nicht online.

  Ochrymiuk, T. (2004) Numerical Investigation of the Flow Field within a Gas Turbine Rotor and Stator Cascade. DLR-Interner Bericht. 225-2004 C 11, 54 S. Volltext nicht online.

  Ochrymiuk, T. und Gieß, P.-A. und Kost, F. (2004) Experimental Investigations of the Flow Field within a Gas Turbine Rotor Cascade without Coolant Ejektion Designed by RRD. Appendix B. DLR-Interner Bericht. 225 - 2003 C 07 B, 56 S. Volltext nicht online.

  Ochrymiuk, T. und Gieß, P.-A. und Kost, F. (2004) Experimental Investigations of the Flow Field within a Gas Turbine Rotor Cascade without Coolant Ejection Designed by RRD. DLR-Interner Bericht. 225-2003 C 07, 36 S. Volltext nicht online.

  Ochrymiuk, T.; Gieß, P.-A.; Kost, F., (2004) Experimental Investigations of the Flow Field within a Gas Turbine Rotor Cascade without Coolant Ejection. Designed by RRD. DLR-Interner Bericht. 225-2003 C 07, 36 S. Volltext nicht online.

  Orth, U. und Ebbing, H. und Krain, H. und Weber, A. und Hoffmann, B. (2001) Improved Compressor Exit Diffuser for an Industrial Gas Turbine. In: ASME Turbo Expo 2001, Seiten 1-10. ASME, New Orleans, USA, June 2001. Volltext nicht online.

  Orth, U. und Ebbing, H. und Krain, H. und Weber, A. und Hoffmann, B. (2002) Improved Compressor Exit Diffuser for an Industrial Gas Turbine. Transactions of the ASME, Journal of Turbomachinery (Vol. 124, January 2002), Seiten 19-26. Volltext nicht online.


  Pahlitzsch, Manuel (2018) Entwicklung einer Matrix-Klasse in der Programmiersprache C++ für den Einsatz in ingenieurwissenschaftlichen Problemstellungen. Bachelorarbeit, Duale Hochschule Baden-Württemberg. Volltext nicht online.

  Pak, H. (1991) Strömungstechnische Untersuchung des Laufrades SRV1 mittels der Ergebnisse numerischer Strömungsrechnungen. FVV-Arbeitskreissitzung, DLR-Köln, 23.10.91. Volltext nicht online.

  Pak, H. (1991) Überlegungen zur Auslegung des zweiten Laufrades für den Radialverdichterprüfstand der DLR. FVV-Arbeitskreissitzung, DLR-Köln, 22.04.91. Volltext nicht online.

  Pak, H. (1993) Vergleich von Stroemungsmessungen und Stroemungsrechnungen am SRV1. FVV-Arbeitskreissitzung &quot;Radialverdichter hoher Schluckfaehigkeit&quot;, 29.10.1993. Volltext nicht online.

  Pak, H. (1993) Stand der Lasermessungen am SRV1. FVV-Arbeitskreissitzung &quot;Radialverdichter hoher Schluckfaehigkeit&quot;, 12.07.1993, Koeln-Porz. Volltext nicht online.

  Pak, H. (1993) Zwischenbericht ueber das Vorhaben Nr. 493 &quot;Radialverdichter hoher Schluckfaehigkeit&quot;. Forschungsvereinigung Verbrennungskraftmaschinen e.V., Frankfurt a.M.. Informationstagung Turbinen, Fruehjahr 1993. Volltext nicht online.

  Pak, H. (1994) Stand der Lasermessungen am SRV2 - Erste Ergebnisse. FVV-Arbeitskreissitzung &quot;Radialverdichter hoher Schluckfaehigkeit&quot;, 27.10.1994, Oberhausen. Volltext nicht online.

  Pak, H. (1994) Ergebnisse der Kennfeldmessungen am SRV2. FFV-Arbeitskreissitzung &quot;Radialverdichter hoher Schluckfaehigkeit&quot;, 21.04.1994, Koeln-Porz. Volltext nicht online.

  Pak, H. und Krain, H. (1992) Zischenbericht ueber Vorhaben Nr. 493 Radialverdichter hoher Schluckfaehigkeit. Informationstagung Turbinen des FVV e.V. am k01.04.92 in Lahnstein. Volltext nicht online.

  Pak, H. und Krain, H. und Hoffmann, B. (1994) Flow Field Analysis in a High Pressure Ratio Centrifugal Compressor. In: AGARD Paper. AGARD Paris. 82nd Symposium, 4.-8. Oct. 93, Montreal, Canada. Volltext nicht online.

  Pak, H. (1992) Stand der Neuauslegung des Laufrades SRV2. FVV-Arbeitskreissitzung "Radialverdichter hoher Schluckfaehigkeit", 05.02.1992, Oberursel. Volltext nicht online.

  Pak, H. (1992) Vorstellung eines Geometrieentwurfs fuer das neue Laufrad SRV2. FVV-Arbeitskreissitzung "Radialverdichter hoher Schluckfaehigkeit", 18.03.1992, Koeln-Porz. Volltext nicht online.

  Pak, H. (1992) Beschreibung des neuen Laufrades SRV2 und vergleichende Untersuchungen der transsonischen Anstroemung fuer den SRV1 und SRV2. FVV-Arbeitskreissitzung "Radialverdichter hoher Schluckfaehigkeit", 16.09.1992 , Zürich, Schweiz. Volltext nicht online.

  Pak, Henry (1993) Stand der Lasermessungen am SRV1. Vortrag: FVV-Arbeitskreissitzung &quot;Radialverdichter hoher Schlucckfaeh igkeit&quot;, 17.02.93, Koeln-Porz. Volltext nicht online.

  Palmberg, Christian (2017) Parametrische Modellierung der Mantelflächen von Propellerblättern zur weiteren Verarbeitung in CAD-Systemen. Bachelorarbeit. DLR-Interner Bericht. DLR-IB-AT-KP-2017-160, 115 S. file

  Paulat, U. (1990) Messung des Waermeuebergangsverhaltens einer stationaeren Rohrstroemung bei unterschiedlichen Einlaufgeometrien. sonstiger Bericht. Volltext nicht online.

  Peters, Andreas und Beversdorff, Manfred und Bunde, Manfred und Dabrock, Theodor und Voges, Melanie und Voigt, Christian (2009) Experimentelle Untersuchung eines Verdichterlaufrades in Tandembauweise für hochbelastete Verdichter. DLR-Interner Bericht. DLR-IB 325-27-09, 56 S. (nicht veröffentlicht) Volltext nicht online.

  Peters, R. (1994) Leistungsanalyse fuer Dual-Mode-Staustrahlantriebe. DLR-Interner Bericht. 325-06-94, 185 S. Volltext nicht online.

  Petzold, A. und Stein, C. und Nyeki, S. und Gysel, M. und Weingartner, E. und Baltensperger, U. und Giebl, H. und Hitzenberger, R. und Döpelheuer, A. und Vrchoticky, S. und Puxbaum, H. und Johnson, M. und Hurley, C.D. und Marsh, R. und Wilson, C.W. (2003) Properties of Jet Engine Combustion Particles during the PartEmis Experiment: Microphysics and Chemistry. Geophysical Research Letters, 30 (13), 52-1-52-4. DOI: 10.1029/2003GL017283 Volltext nicht online.

  Pfister, T. und Büttner, L. und Czarske, J. und Krain, H. und Schodl, R. (2006) Turbo machine tip clearance and vibration measurements using a fibre optic laser Doppler position sensor. Measurement Science and Technology, Seiten 1-13. Volltext nicht online.

  Pfister, Thorsten und Büttner, Lars und Czarske, Jürgen und Krain, Hartmut und Schodl, Richard (2008) Fiber optic laser Doppler distance sensor for in-situ tip clearance and vibration monitoring of turbo machines. In: 14th Int Symp on Applications of Laser Techniques to Fluid Mechanics, Seite 11. 14th Int Symp on Applications of Laser Techniques to Fluid Mechanics, 07-10 July, 2008, Lisbon, Portugal. Volltext nicht online.

  Pfizenmaier, E. (1996) Lärmbekämpfung bei schnellen Verkehrsmitteln. AGF-Forschung &quot;Technik für die Umwelt&quot;, 1996, Seiten 6-8. Volltext nicht online.

  Pfizenmaier, E. (1995) Über konvektive und absolute Instabilitaet in Freistrahlen und Flammen. Seminar &quot;Turbulente Strömungen&quot; am HFI der TU Berlin, 31.01.1995.. Volltext nicht online.

  Pfizenmaier, E. (1995) Lärmarme Stromabnehmer. Workshop &quot;Stromabnehmer&quot;, DLR und Deutsche Bahn AG , Braunschweig, 11.07.1995. Volltext nicht online.

  Pfizenmaier, E. (1995) Über die Vergleichbarkeit des mit verschiedenen Thromboplastinreagenzien und Blutgerinnungstestgeraeten ermittelten INR-Werten bei der Marcumarbehandlung - dargestellt an Messungen mit den Testgeraeten Biotrack 512 und CoaguCheck. DLR-Interner Bericht. 92517-95/B3, 49 S. Volltext nicht online.

  Pfizenmaier, E. (1997) On abating pantograph noise demonstrated with elements of the DAS 350 SEK. 2nd International Workshop on the Aeroacoustics of High-Speed Trains, Berlin, 29.4.1997. Volltext nicht online.

  Pfizenmaier, E. und Bechert, D. W. (1995) Beeinflussung der Profilverluste und Sekundärströmung durch Oberflächenstrukturen. ABB-DLR-Workshop, Baden/Schweiz, 20.10.1995. Volltext nicht online.

  Pfizenmaier, E. und Blaschko, R. und Siemens, H. (1996) Experimentelle Untersuchungen zur Entwicklung auftriebsarmer Schleifleisten für den ICE im Niedergeschwindigkeitswindkanal der TU Dresden. Projektbericht, DLR-Interner Bericht. 92517-96/B1, Teil I: 105 S., 81 Bild., 7 Tab.; Teil II: 126 Tab.. Volltext nicht online.

  Pfizenmaier, E. und Blaschko, R. (1) und Siemens, H. (2) (1996) Weitere experimentelle Untersuchungen zur Entwicklung auftriebsarmer Schleifleisten fuer Stromabnehmer des ICE im Windkanal der TU Dresden. DLR-Interner Bericht. 92517-96/B8 (1996); Teil I: 69 S., 61 Bild., 1 Lit., Teil II: 100 Tab.. Volltext nicht online.

  Pfizenmaier, E. und King III, W. F. und Neuhaus, L. (1995) Experimentelle Untersuchungen an 1:10-Modellen des ICE 2.2 im Akustik-Windkanal der DLR in Braunschweig. DLR-Interner Bericht. 92517-95/B7, 58 S. Volltext nicht online.

  Pfizenmaier, E. und King III, W.F. und März, J. und Herrmann, M. (1997) Akustische Untersuchungen an zwei Stromabnehmern der Firmen Adtranz und Siemens im DNW. DLR-Interner Bericht. 92517-97/B4, 119 S. Volltext nicht online.

  Plohr, M. (1998) Experimentelle Untersuchung der 2-Phasen-Strömung einer Vorverdampferdüse für die magere, vorgemischte und vorverdampfte Verbrennung. Diplomarbeit. DLR-Interner Bericht. Volltext nicht online.

  Plohr, M. und Döpelheuer, A. und Lecht, M. (1999) The Gas Turbine Heat Cycle and its Influence on Fuel Efficiency and Emissions. In: Gas Turbine Operation and Technology for Land, Sea and Air Propulsion and Power Systems. RTO-Symposium Gas Turbine Operation and Technology for Land, Sea and Air Propulsion and Power Systems, Ottawa, Kanada, Oct. 99. Volltext nicht online.

  Plohr, M. und von der Bank, R. und Schilling, T. (2003) Vergleich des Emissionsverhaltens effizienter Hochbypasstriebwerke mittlerer Schubgröße für den ICAO LTO-Zyklus und Flugmissionen. In: DGLR Jahrbuch 2003, (CD). DGLR. Deutscher Luft- und Raumfahrtkongress 2003, München, 17.-20. November 2003. Volltext nicht online.

  Plohr, M, und Döpelheuer, A. und Lecht, M. (1999) The Gas Turbine Heat Cycle and its Influence on Fuel Effiency and Emissions. Gas Turbine Operation for Land, Sea and Air Propulsion and Power Systems, AVT Panel Meeting, Ottawa, Canada, 21.10.99. Volltext nicht online.

  Pokorny, S. und Engel, K. und Faden, M. (1991) Lösung partieller DGL-Systeme mit TVD-Verfahren. Vortrag Universität Bonn, 26.11.91. Volltext nicht online.

  Pokorny, S. und Faden, M. und Engel, K. (1991) An integrated flow simulation system on a parallel computer, part I: Basic Concept. 7th International Conference on Numerical Methods in Laminar and Turbulent Flow. Volltext nicht online.

  Pokorny, S. und Faden, M. und Engel, K. (1991) Implementierung eines interaktiven Strömungssimulationssystems, Teil 1. GAMM Seminar &quot;Numerische Algorithmen auf Transputersystemen&quot;, Juni 1991, Heidelberg. Volltext nicht online.

  Pokorny, S. und Faden, M. und Engel, K. (1991) An Integrated Flow Simulation System on a parallel Computer, Part I: Basic Concept. 7th International Conference on Numerical Methods in Laminar and Turbulent Flow. Volltext nicht online.

  Pokorny, S. und Faden, M. und Engel, K. (1991) Integriertes Strömungssimulationssystem auf einem Parallelrechner, Teil 1: Basis Konzept. Seminarvortrag IWR Heidelberg. Volltext nicht online.

  Pokorny, S. und Faden, M. und Engel, K. (1991) Development of a Simulation System for 3-Dimensional Unsteady Turbomachinery Flow. In: Flow Simulation with High-Performance Computer I Notes on Numerical Fluid Mechanics, Vieweg Verlag. Vieweg. Volltext nicht online.

  Pommerening, S. (1994) Charakterisierung einer Wasserstoffbrennkammer als Heissgasgenerator eines Duesenmodellpruefstandes fuer Grundlagenuntersuchungen zum Hyperschallantrieb. sonstiger Bericht. Volltext nicht online.


  R. Fuchs, H.A. Schreiber (1992) Entwicklung einer Entwurfsmethode fuer transsonische Axialverdichter-gitter-Vorstellung des Vorhabens. Vortrag 4. Arbeitskreissitzung AG-Tubo-Turbotech, 16.-17.03.92 in Koeln-Porz. Volltext nicht online.

  R. Schodl, (1992) Triebwerksmetechnik - Aufgaben, Struktur, Kooperationen, Ergebnisse. DLR-SM-AT-Seminar, Mai 1992. Volltext nicht online.

  R. Schodl, (1992) Neue Entwicklungen beim L2F-Verfahren. Workshop: &quot;Lasermethoden in der Stroemungsmeßtechnik&quot;, 29.-30.09.92 in Karlsruhe. Volltext nicht online.

  R. Schodl, (1992) Development of 3D-Velocimeters based on the Laser2-Focus Technique. 11th Symposium on &quot;Measuring Techniques for Transonic and Supersonic Flow in Cascades and Turbomachines&quot;, 14.-15.09.92, Muenchen. Volltext nicht online.

  Rachner, M. (1998) Application of numerical spray simulation to accompany experiments in the LPP premise duct at DLR. BRITE/EURAM Low NOxIII - Focused Generics- Meeting No. 5, München, 10.02.1998. Volltext nicht online.

  Rachner, M. (1999) Realgasverhalten und Phasengleichgewicht bei hohen Drücken. Instituts-Seminarvortrag, Inst. für Verbrennungstechnik, Stuttgart, 13.12.1999. Volltext nicht online.

  Rachner, M. (1990) Calculation of Gas Turbine Combustion Chamber Flow on Staggered and Nonstaggered Grid. Deutsch-brasilianischer Workshop am Institut fuer Theoretische Stroem ungsmechanik der DLR, Goettingen, 6. Maerz 1990. Volltext nicht online.

  Rachner, M. (1991) Flow computation in combustion chambers using zonal nonstaggered grids. AGARD PEP 77th Symp. on CFD Techniques for propulsion applications, San Antonio, Texas, USA, 27.-31.05.91. Volltext nicht online.

  Rachner, M. (1996) Untersuchung zweier Modelle zur Beschreibung der turbulenten Partikeldispersion über der Lagrange'schen Partikelverfolgung. DLR-Interner Bericht. 325-13-96, 30 S. Volltext nicht online.

  Rachner, M. (1996) Zum Einfluss der Anfangstropfengroessenverteilung auf die Sprayausbreitung im LPP-Vormischkanal. DLR-Interner Bericht. 325-14-96, 29 S. Volltext nicht online.

  Rachner, M. (1998) Application of numerical spray simulation to accompany experiments in the LPP premix duct at DLR. DLR-Interner Bericht. 325-01-98, 31 S. Volltext nicht online.

  Rachner, M. (1997) Stoffwerteformeln fuer Kerosin Jet A-1 im gasturbinenrelevanten Druckbereich auf der Basis einer kritischen Durchsicht von Literaturdaten. DLR-Interner Bericht. 325-03-97, 71 S. Volltext nicht online.

  Rachner, M. und Becker, J. (2000) Modelling of the atomization of a plain liquid jet in crossflow in the LPP premise duct at DLR. DLR-Interner Bericht. 325-07-2000, 27 S. Volltext nicht online.

  Rachner, M. und Brandt, M. und Eickhoff, H. und Hassa, C. und Braeuner, A. und Kraemer, H. und Ridder, M. und Sick, V. (1996) A Numerical and Experimental Study of Fuel Evaporation and Mixing for Lean Premixed Combustion at High Pressure. 26th Symposium on Combustion, Naples, Italy, July 28-August 2, 1996, erscheint in: Proceedings of the 26th Symp. Intern. of Combustion. Volltext nicht online.

  Rachner, M. und Eickhoff, H. (1999) Ausbreitung, Verdunstung und Verbrennung von Sprays. CRAY-TECFLAM Abschlußkolloquium/14. TECFLAM-Seminar, TU Darmstadt, 19.03.1999. Volltext nicht online.

  Rachner, M. und Koopman, J. (1991) Fundamentals and Application of CFD to Combustors. Space Course, Aachen, 18.02.-08.03.91. Volltext nicht online.

  Rachner, M. und Schmitz, G. und Hassa, C. und Schütz, H. und Eickhoff, H. (1998) Numerische Untersuchung einer verdrallten Kerosin-Sprayflamme in einer Modellbrennkammer. In: erscheint in den Proceedings des 4. Workshop zur Technik der Fluidzerstäubung und Erfassung von Sprühvorgängen, 7-. Spray '98, Uni GH Essen, 13.-14.10.1998. Volltext nicht online.

  Rachner, M. und Schütz, H. und Eickhoff, H. (1999) Entwicklung einer Software zur Simulation von technischen Verbrennungsvorgängen, Teilprojekt 1: Basiscodebereitstellung und Modellintegration. Projektbericht. BMBF-Förderkennzeichen: 0326839A, 27 S. Volltext nicht online.

  Rachner, M. und Schütz, H. und Theisen, P. (1999) KIVA-Online-Manual zum CRAY-TECFLAM-Projekt, darin die Kapitel &quot;Equations for velocity, energy and k-epsilon-turbulence/Numerics&quot; - Spray ISDM-model&quot;. Projektbericht, DLR-Interner Bericht. Volltext nicht online.

  Rachner, Michael (1998) Die Stoffeigenschaften von Kerosin Jet A-1. DLR-Mitteilungen 98-01 (1). file

  Rachner M., (2000) Modellierung der Zerstäubung eines flüssigen Strahls in einer Querströmung in einem LPP-Vormischkanal. Interner Workshop des DLR-Projekts Brennkammermodellierung, Inst. f. Antriebstechnik, DLR Köln, 23.11.2000. Volltext nicht online.

  Rachwitz, L. und Dörr, T. und Heinze, J. und Jarius, M. und Stursberg, K. (2002) Experimentelle und theoretische Untersuchung des Brennstoffaufbereitung in mager vorgemischten Flammen. DGLR-2002-059, Stuttgart, 23.-26. September, 2002. Volltext nicht online.

  Rackwitz, L. und Heinze, J. und Becker, J. (2004) Development of a piloted lean burner for an aero-engine combustor: influence of liquid fuel placement on pollutant emissions. In: 19th ilass Europe'04, 19, Seiten 25-31. Alpha Graphics Nottingham. 19. Int. Conf. on Liquid Atomization and Spray Systems. Volltext nicht online.

  Raede, M. (1995) Parametrische Analyse über den Einfluß des Bypass-Verhältnisses heutiger Luftfahrt-Triebwerke auf ihre Stickoxidemissionen. DLR-Interner Bericht. 325-05-95, 49 S. Volltext nicht online.

  Raffel, M. und Schodl, R. und Bütefisch, K.A. und Kompenhans, J. und Willert, C. und Röhle, I. (1999) Über verschiedene Verfahren der optischen Messung der Strömungsgeschwindigkeit. DGLR Fachtagung, Meßtechnik und Sensorik für die Luftfahrt, Braunschweig, 1.-2. Juni 1999. Volltext nicht online.

  Raffel, Markus und Willert, Christian und Kompenhans, Jürgen und Loose, Sigfried und Bosbach, Johannes (2004) Measurement of unsteady flow fields. In: Unsteady Flow Effects Progress in Vehicle Aerodynamics, 3. Expert Verlag. Seiten 177-191. ISBN 3-8169-2380-1. Volltext nicht online.

  Raitor, T. und Neise, W. und Hoffmann, B. und Mönig, R. (2007) Schallreduzierung bei Radialverdichtern (Radialverdichterlärm IIb). Abschlussbericht über das Vorhaben FVV-Nr. 901 (AIF-Nr. 14733N/1). In: Forschungsvereinigung Verbrennungskraftmaschinen, Heft R 538, Seiten 113-150. Informationstagung Turbomaschinen, FVV-Frühjahrstagung, 2007-03-22, Frankfurt/Main. Volltext nicht online.

  Raitor, T. und Neise, W. und Hoffmann, B. und Mönig, R. (2007) Schallreduzierung bei Radialverdichtern (Radialverdichterlärm IIb). Abschlussbericht über das Vorhaben FVV-Nr. 901 (AIF-Nr. 14733N/1). andere. Projektbericht. Volltext nicht online.

  Raitor, T. und Neise, W. und Hoffmann, B. und Mönig, R. und Enghardt, L. (2009) Schallemission von Radialverdichtern mit Kompaktdiffusor (Radialverdichterlärm III, Abschlussbericht zum Vorhaben 949). In: FVV Informationstagung Turbomaschinen, Frühjahrstagung 2009, Heft R546, Heft R546, Seiten 141-175. Forschungsvereinigung Verbrennungskraftmaschinen. Informationstagung Motoren/Turbomaschinen, FVV-Frühjahrstagung 2009, 02.April 2009, Bad Neuenahr. Volltext nicht online.

  Raitor, T. und Neise, W. und Hoffmann, B. und Mönig, R. und Enghardt, L. (2009) Schallemission von Radialverdichtern mit Kompaktdiffusor. (Radialverdichterlärm III, Abschlussbericht zum Vorhaben 949). Projektbericht. Forschungsvereinigung Verbrennungskraftmaschienen. Volltext nicht online.

  Raitor, T. und Neise, W. und Mönig, R. (2004) Schallentstehung bei Radialverdichtern. Abschlussbericht über das Vorhaben Nr. 781 (AIF-Nr. 13041 N). Informationstagung Turbinen, FVV-Herbsttagung, Pforzheim, 23. September 2004. Volltext nicht online.

  Raitor, T. und Neise, W. und Mönig, R. (2004) Schallentstehung bei Radialverdichtern. Abschlussbericht über das Vorhaben Nr. 781 (AIF-Nr. 13041 N). Forschungsvereinigung Verbrennungskraftmaschinen, 787 (787). Volltext nicht online.

  Rasouli Ghazi Kalayeh, Keyvan und Jeschke, Peter und Kluxen, Robert und Schäfer, Philipp (2014) Numerical evaluation of different hub geometries in an exhaust diffuser. Masterarbeit, RWTH Aachen. Volltext nicht online.

  Rasouli Ghazi Kalayeh, Keyvan und Schäfer, Philipp und Finzel, Conrad und Hofmann, Willy (2015) Experimental And Numerical Study Of A Gas Turbine Exhaust Diffuser Applying Different Hub Extension Geometries. In: 11th European Turbomachinery Conference. EUROPEAN TURBOMACHINERY CONFERENCE, 23.-27.03.2015, Madrid, Spanien. Volltext nicht online.

  Rehder, H.-J. (2001) Nozzle Guide Vane Assembly Modifications at the Windtunnel for Rotating Cascades (RGG). DLR-Interner Bericht, Projektbericht. 225-2001 A 03, 17 S. Volltext nicht online.

  Rehder, H.-J. (2004) DLR Flow Field Measurements - European Research Project AITEB -. DLR-Interner Bericht, Projektbericht. 225-2004 A 12, 70 S. Volltext nicht online.

  Rehder, H.-J. und Dannhauer, A. (2004) DLR Rig Instrumentation -European Research Project AITEB-. DLR-Interner Bericht, Projektbericht. 225-2004 A 08. Volltext nicht online.

  Rehder, H.-J. und Kost, F. und Kessar, A. (2003) Low Engine Order NGV Only Tests at DLR. DLR-Interner Bericht. 225-2003 A 06, 47 S. Volltext nicht online.

  Rehder, H.-J. und Kost, F. und Kessar, A. (2005) Low Engine Order Stage Tests at DLR (Time-Averaged Results). DLR-Interner Bericht, Projektbericht. 225-2005 A 02, 100 S. Volltext nicht online.

  Rehder, Hans-Jürgen (2015) Massenflussmessungen am Turbinenprüfstand NG-Turb. DLR-Interner Bericht. DLR - IB 225 - 2015 A01. (nicht veröffentlicht) Volltext nicht online.

  Reitenbach, Stanislaus und Schnoes, Markus und Becker, Richard-Gregor und Otten, Tom (2015) OPTIMIZATION OF COMPRESSOR VARIABLE GEOMETRY SETTINGS USING MULTI-FIDELITY SIMULATION. ASME Turbo Expo 2015, 15.-19. Juni 2015, Montreal, Kanada. DOI: 10.1115/GT2015-42832 ISBN 978-0-7918-5665-9 Volltext nicht online.

  Ren, Celine (2010) Calibration of a four-hole mini probe in sub-, trans- and supersonic flow. DLR-Interner Bericht. DLR-IB 225-2010 A08. Volltext nicht frei. file

  Reyl, M. und Elfert, M. (1992) Experimentelle Analyse der Stroemung in einem rotirenden Kanal mit Hilfe eines L2F-Velozimeters. DLR-Interner Bericht. 325-05-92, 160 S. Volltext nicht online.

  Ripplinger, T. und Brandt, M. und Hassa, C. (1996) Schadstoffreduktion durch Magerverbrennung und Vorvermischung und Messung der Zweiphasen-Strömung. Sekretariat AG-Turbo, 51170 Köln. Volltext nicht online.

  Ripplinger, Th. und Zarzalis, N. und Brandt, M. und Hassa, C. (1998) Entwicklungsstadien eines Konzeptes zur mageren Verbrennung mit Vorverdampfung und Vorvermischung des flüssigen Brennstoffs. In: 6. Statusseminar Arbeitsgemeinschaft Hochtemperatur Gasturbine, 3-1-3-11. 6. Statusseminar AG Turbo, DLR Köln, 3.12.1998. Volltext nicht online.

  Ripplinger, Th. und Zarzalis, N. und Meikis, G. und Hassa, C. und Brandt, M. (1998) NOx Reduction by Lean Premixed Prevaporized Combustion. In: Gas Turbine Engine Combustion, Emissions and Alternative Fuels, 7-1-7-12. RTO Symposium, Lissabon, Portugal, 12.10.1998. ISBN 92-837-0009-0 Volltext nicht online.

  Roehle, I. (2000) Doppler global Velocimetry: Grundlagen und Anwendungen. Beitrag zu einem Lehrgang, TU Darmstadt, 9.-11. Okt. 2000. Volltext nicht online.

  Roehle, I. (1993) Velocity Measurements with the Doppler Global Technique. Vortrag auf der Tagung &quot;Euromech 309&quot; vom 28.09.-01.10.93, DLR Goetti ngen. Volltext nicht online.

  Roehle, I. (1996) Three-Dimensional Doppler Global Velocimetry in the flow of a fuel spray nozzle and in the wake region of a car. Flow Measurement Instrumentation, No 3/4, Seiten 287-294. Volltext nicht online.

  Roehle, I. und Schodl, R. (1994) Evaluation of the accuracy of the Doppler Global technique. Vortrag auf der Tagung &quot;Optical Methods and Dato Processing on Heat a nd Fluid Flows&quot;, 14.-15. April 1994 in London. Volltext nicht online.

  Roehle, I. und Schodl, R. (1994) Evaluation of the accuracy of the Doppler Global technique. Volltext nicht online.

  Roehle, I. und Schodl, R. (1994) Geschwindigkeitsmessungen mit Doppler-Global-Velocimetry. Vortrag am Institut Saint Louis, 13.12.1994. Volltext nicht online.

  Roehle, I. und Schodl, R. (1994) Beschreibung des 3D-Doppler-Laser-Zwei-Fokus-Verfahrens. DLR-Interner Bericht. 325-15-94, 30 S. Volltext nicht online.

  Roehle, I. und Schodl, R. (1994) Fortschritte in der Doppler Global Velocimetry. Vortrag bei der DLR-internen Konferenz LIF 7 in Stuttgart Konferenzproceeding &quot;LIF 7&quot;. Volltext nicht online.

  Roehle, I. und Schodl, R. (1994) Progress Report Doppler Global Velocimetry. DLR-ONERA-Messtechnik-Kooperation, Treffen in Lampoldshausen. Volltext nicht online.

  Roehle, I. und Schodl, R. (1996) Demonstration eines DGV-Systems im Windkanal bei Mercedes Benz. Demonstrationsversuch bei Mercedes Benz in Sindelfingen, 14.6.96. Volltext nicht online.

  Roehle, I. und Schodl, R. (1996) Doppler Global Velocimetry in the Flow of a Swirler. 8th International Symposium on Applications of Laser Techniques to Fluid Mechanics, Lissabon, Portugal. Volltext nicht online.

  Roehle, I. und Schodl, R. (1996) Doppler Global Velocimetry in the Flow of a Swirler and in the Wake Region of a Car. Vortrag bei NASA-Langley, 4.04.96. Volltext nicht online.

  Roehle, I. und Schodl, R. (1996) Doppler Global Velocimetry in der Stroemung einer Drallduese und im Nachlauf eines PKW-Modells bei Mercedes Benz. Vortrag auf LIF 8, 18.-10.12.1996, Koeln. Volltext nicht online.

  Roehle, I. und Schodl, R. (1997) 3D-Doppler-Global Velocimetry in the Flow of a Fuel Spray Nozzle and in the Flow of an Engine Inlet Model. 90th Symposium of AGARD-PEP on Advanced Non-Intrusive Instrumentation for Propulsion Engines, Oct. 20-24, 1997, Bruessel. Volltext nicht online.

  Roehle, I. und Schodl, R. (1997) Application of Three-dimensional Doppler-Global Velocimetry to Turbomachinery and Wind-Tunnel Flow. In: Proceedings 7th Int. Conf. &quot;Laser Anemometry Advances and Applications&quot; 1997. 7th Int. Conference &quot;Laser Anemometry Advances and Applications&quot;, Sept. 8-11, Karlsruhe, 1997. Volltext nicht online.

  Roehle, I. und Voigt, P. und Schodl, R. und Willert, C. (2000) Recent developments and applications of quantitative planar measuring techniques in turbomachinery components. Measurements Science & Technology, 11 (11), Seiten 1023-1035. Volltext nicht online.

  Roehle, I. und Willert, C. (2001) Extension of Doppler Global Velocimetry to periodic flows. Measurement, Science Technology, Institute of Physics Publishing, April 2001 (2001), 12 (4), Seiten 420-431. Volltext nicht online.

  Roehle, I. und Willert, C. und Schodl, R. (1998) Applications of Three-Dimensional Doppler Global Velocimetry in Turbo-Machinery. 8th International Symposium on Flow Visualisation, Sorrento, Italien, 1-4 Sept. 1998. Volltext nicht online.

  Roehle, I. und Willert, C. und Schodl, R. (1998) Recent Applications of Three-Dimensional Doppler-Global Velocimetry in Turbo-Machinery. 9th International Symposium on Applications of Laser Techniques to Fluid Mechanics, Lisbon, Portugal, 13-16 July, 1998. Volltext nicht online.

  Roehle, I. und Schodl, R. (1992) Untersuchungen zur Ermittlung des Genauigkeitspotentials der Doppler Global Mehtode zur 2D-Geschwindigkeitsanalyse. DLR-SM-AT-Seminar , 1992, Göttingen. Volltext nicht online.

  Roehle, Ingo (1993) Laser-Doppler-Velocimetry auf der Basis frequenzselektiver Absorption. Diplomarbeit. DLR-Interner Bericht. 325-08-93, 120 S. Volltext nicht online.

  Rost, W. und Schnell, R. (2004) Numerische Untersuchung der Zwischendiffusorströmung eines Flugtriebwerkes. Diplomarbeit. DLR-Interner Bericht. 325-15-04, 59 S. Volltext nicht online.

  Röber, T, und Kozulovic, D, und Kügeler, E, und Nürnberger, D, (2005) Appropriate Turbulence Modelling for Turbomachinery Flows. In: Strömungen mit Ablösung, 14. DGLR-Fach-Symposium Bremen, 14. - 16. November 2004. Springer Verlag. 14th DGLR-Symposium of STAB, Bremen, Nov 16-18, 2004. Volltext nicht online.

  Röhle, I. (1998) Doppler Global Velocimetry. VKI-Brüssel, B. Lecture Series, Advanced Measurement Techniques, Brüssel-VKI, Juni 1998. Volltext nicht online.

  Röhle, I. (1999) Doppler Global Velocimetry; Principle and Application I+II. Planar optical measurement techniques for Gas Turbine components, RTO Lecture Series, Cleveland, USA, Sept. 99. Volltext nicht online.

  Röhle, I. (1999) Doppler Global Velocimetry. In: Planar Optical Measurement Methods for Gas Turbine Components, 217, 4.1-4.22. RTO, F-92201 Neuilly sur Seine, France. Lecture Series, Cranfield, GB, 16.-17.Sept. 99/Cleveland, USA, 21.-22.Sept. 99. Volltext nicht online.

  Röhle, I. (1999) Doppler Global Velocimetry: Grundlagen und Anwendungen. In: Strömungsmesstechnik in der industriellen Forschung, 23.1-23.45. TU Darmstadt, FB Strömungslehre. Kurzlehrgang Strömungsmesstechnik in der industriellen Forschung, Darmstadt, 11.-14. Okt. 1999. Volltext nicht online.

  Röhle, I. (2001) Application of novel developed laser diagnostic techniques to turbo-machinery facilities. 1. Preis für die Dissertation, Pratt & Whitney /EREA Award 2001, Verleihung in Brüssel, 9. Mai, 2001. Volltext nicht online.

  Röhle, I. und Fradin, C. und LeGuevel, A. (1998) Traces based Shock Visualisation in the Blade Passage of the Rotor of a Transonic Axial Compressor. IMechE, Birdcagewalk 1, London. Optical Methods in Heat and Fluid Flow, City University, London, 16.-17.April 1998. ISBN 186058 1420 / ISSN 1356-1448 Volltext nicht online.

  Röhle, I. und Fradin, C. und LeGuevel, A. (1999) Tracer-based Shock Visualisation in a Transonic Compressor. Journal Optics & Laser Technology, 31 (1), Seiten 67-73. Volltext nicht online.

  Röhle, I. und Karpinski, G. und Schodl, R. (1999) 3C-Doppler-L2F: A new Kind of Three Component Anemometer. ONERA, Toulouse, France. 18th International Congress on Instrumentation in Aerospace Simulation Facilities (ICIASF), Toulouse, France, 14.-17. June 199. Volltext nicht online.

  Röhle, I. und Schodl, R. (1995) Flächige Echtzeit-Geschwindigkeitsmessung mit Doppler-Global-Velocimetrie. Zentrumskolloquium, Göttingen, 2./3.11.1995. Volltext nicht online.

  Röhle, I. und Schodl, R. (1995) Doppler-Global-Geschwindigkeitsmessungen an einer Dralldüse. Zentrumskolloquium Göttingen, 2./3.11.1995. Volltext nicht online.

  Röhle, I. und Schodl, R. (1996) Praesentation eines DGV-Systems und Demo-DGV-Messungen in einem Windkanal an einem PKW-Modell. Vortrag bei Mercedes-Benz, 14.6.96, Stuttgart. Volltext nicht online.

  Röhle, I. und Schodl, R. und Voigt, P. und Willert, C. (2000) Recent developments and applications of quantitative laser light sheet measuring techniques in turbomachinery components. Measurement, Science & Technology, 11 (7), Seiten 1023-1035. Volltext nicht online.

  Röhle, I. und Schodl, R. und Weyer, H.B. (1998) 3D-Shock Visualization in a Transonic Compressor. International Workshop &quot;Flow Diagnosis Techniques&quot;, St. Petersburg, June 30 - July 3, 1998. Volltext nicht online.

  Röhle, I. und Willert, C. und Bake, F. (2004) Micro DVG and Filtered Rayleigh Scattering - two challenging techniques using iodine cells. DLR/ONERA - Annex II Meeting, Köln, 6. - 7. April 2004. Volltext nicht online.

  Röhle, I. und Willert, C. und Schodl, R. (1998) Applications of Three-Dimensional Doppler Global Velocimetry in Turbo-Machinery. In: Proc. 8th International Symposium on Flow Visualization, 157.1-157.10. 8th International Symposium on Flow Visualization, Sorrento, Italia, 1.-4. Sept. 1998. Volltext nicht online.

  Röhle, I. und Willert, C. und Schodl, R. (1998) Recent Applications of Doppler Global Velocimetry in Turbo-Machinery. 9th Symposium on Applications of Laser Techniques to Fluid Mechanics, Lisbon, Pt, 13.-16. Juli 1998. Volltext nicht online.

  Röhle, Ingo (1999) Laser Doppler Velocimetry auf der Basis frequenzselektierter Absorption: Aufbau und Einsatz eines Doppler Global Velocimeters. Dissertation. DLR-Forschungsbericht. 1999-40, 180 S. Volltext nicht online.

  Römer, H. (1991) Erstellung und Auswertung von numerischen, sowie Auswertung von experimentell gewonnenen Daten für einen rotierenden Kühlkanal. DLR-Interner Bericht. 325-14-91, 109 S. Volltext nicht online.


  S. Pokorny, K. Engel, M. Faden, (1992) Berechnung der instatioinaeren Stroemung im gegenlaeufigen Geblaese. Kolloquium Energietechnik Ruhr-Uni Bochum. Volltext nicht online.

  S. Pokorny, K. Engel, M. Faden, (1992) Development of a 3-D flow simulation system on a parallel computer for turbomachinery. In: Volltext nicht online.

  S. Pokorny, K. Engel, M. Faden, (1992) Objektoriedntierte Methoden in der Stroemungsmechanik fuer massiv parallele Rechner. Kolloquium Stroemungsmaschinen Universitaet Essen, 29.06.92. Volltext nicht online.

  Salom, R. (2002) Konstruktion für optische Strömungsuntersuchungen in einem Hubkolbenmotor. Diplomarbeit. DLR-Interner Bericht. 325-05-02. Volltext nicht online.

  Sausen, R. und Nodorp, D. und Land, C. und Deidewig, F. (1996) Ermittlung optimaler Flughöhen und Flugrouten unter dem Aspekt minimaler Klimawirksamkeit. DLR-Forschungsbericht. 96-13, 105 S. Volltext nicht online.

  Schaefer, Martin und Grimme, Wolfgang (2008) The variability of air transport's specific emissions and implications for airline strategies. First CEAS European Air and Space Conference, 2007-09-10 - 2007-09-13, Berlin. Volltext nicht online.

  Schaefer, Martin und Jung, Martin und Pabst, Holger (2013) The Regional Distribution of Air Traffic Emissions in the Past, Present and Future. In: Deutsche Nationalbibliothek. Deutscher Luft- und Raumfahrtkongress 2013, 10.-12. Sep. 2013, Stuttgart, Deutschland. Volltext nicht online.

  Scheelhaase, Janina und Keimel, Hermann und Murphy, Melanie und Sausen, Robert und Schaefer, Martin und Wolters, Florian (2012) How to address aviation's full climate impact best from an economic point of view? - AviClim project overview and first results. Air Transport Research Society (ATRS) 2012 Tainan, 27.-30. Jun. 2012, Tainan, Taiwan. Volltext nicht online.

  Scheelhaase, Janina und Murphy, Melanie und Keimel, Hermann und Sausen, Robert und Schaefer, Martin und Wolters, Florian (2013) How to address aviation's full climate impact best from an economic point of view? - AviClim project overview and update on first results. In: XIII World Conference on Transport Research (WCTR) Proceedings. XIII World Conference on Transport Research (WCTR), 15.-18. Juli 2013, Rio de Janeiro, Brasilien. Volltext nicht online.

  Scheelhaase, Janina und Schaefer, Martin und Grimme, Wolfgang und Maertens, Sven (2013) Cost Impacts of the EU Emissions Trading Scheme on Aviation in the Time Period 2012 - 2020. Annual Transportation Research Forum 2013, 21.-23. März 2013, Annapolis, USA. (nicht veröffentlicht) Volltext nicht online.

  Scheelhaase, Janina und Dahlmann, Katrin und Jung, Martin und Keimel, Hermann und Murphy, Melanie und Nieße, Hendrik und Sausen, Robert und Schaefer, Martin und Wolters, Florian (2015) Die Einbeziehung des Luftverkehrs in internationale Klimaschutzprotokolle (AviClim) - Abschlussbericht. DLR-Forschungsbericht. file

  Scheelhaase, Janina und Dahlmann, Katrin und Jung, Martin und Keimel, Hermann und Nieße, Hendrik und Sausen, Robert und Schaefer, Martin und Wolters, Florian (2016) How to best address aviation’s full climate impact from an economic policy point of view? – Main results from AviClim research project. Transportation Research Part D: Transport and Environment (45), Seiten 112-125. Elsevier. DOI: 10.1016/j.trd.2015.09.002 ISSN 1361-9209 file

  Scheelhaase, Janina und Sausen, Robert und Dahlmann, Katrin und Jung, Martin und Keimel, Hermann und Nieße, Hendrik und Schaefer, Martin und Wolters, Florian (2015) Economic and Environmental Impacts of Market-Based Measures for the Limitation of Aviation’s full Climate Impact. In: Proceeding of the 2015 TRF Annual Forum. 2015 TRF Annual Forum, 12.-14. März 2015, Atlanta, USA. Volltext nicht online.

  Scheelhaase, Janina und Sausen, Robert und Dahlmann, Katrin und Jung, Martin und Keimel, Hermann und Nieße, Hendrik und Schaefer, Martin und Wolters, Florian (2016) Factors determining airlines' costs for climate protecting market-based measures. In: Proceedings of the 14th World Conference on Transport Research (WCTR), Seiten 1-16. Elsevier B. V.. 14th World Conference on Transport Research (WCTR), 10.-15. Juli 2016, Shanghai, China. ISSN 2214-241X file

  Scheelhaase, Janina/JS und Sausen, Robert/RS und Dahlmann, Katrin/KD und Jung, Martin/MJ und Keimel, Hermann/HK und Nieße, Hendrik/HN und Schaefer, Martin/MS und Wolters, Florian/FW (2014) Best options for regulating air transport’s full climate impact from an economic and en-vironmental point of view – Main results from DLR research project AviClim. World Conference of Air Transport Society (ATRS) 2014, 17.-20.07.2014, Bordeaux, Frankreich. Volltext nicht online.

  Scheelhaase, Janina/JS und Sausen, Robert/RS und Dahlmann, Katrin/KD und Jung, Martin/MJ und Keimel, Hermann/HK und Nieße, Hendrik/HN und Schaefer, Martin/MS und Wolters, Florian/FW (2014) Best options for regulating air transport’s full climate impact from an economic and environmental point of view – Main results from DLR research project AviClim. In: AIAA/3AF Aircraft Noise and Emissions Reduction SYmposium (ANERS) 2014 Proceedings. AIAA/3AF Aircraft Noise and Emissions Reduction Symposium (ANERS), 18.-20. Juni 2014, Atlanta, USA. Volltext nicht online.

  Schimming, P. (1999) Entwicklungstendenzen bei luftatmenden Triebwerken aus Sicht der Forschung. Lehrgang &quot;Aktuelle Triebwerkstechnologie&quot; an der Bundesakademie für Wehrverwaltung und Wehrtechnik, Mannheim, 24.9.99. Volltext nicht online.

  Schimming, P. (1999) Triebwerksverdichter: Transsonikverdichter I. Seminarvortrag, Ruhr-Universität Bochum, 19.5.99. Volltext nicht online.

  Schimming, P. (1999) Strömungsuntersuchungen in einem 5-stufigen Axialverdichter. 18. Arbeitskreissitzung Turbotech II, Köln-Porz, 11.03.99. Volltext nicht online.

  Schimming, P. (1999) 3D-Lasermessungen und Rechnungen in transsonischen Verdichtern. Vortrag ABB Alston Power, Baden, Schweiz, 29.11.1999. Volltext nicht online.

  Schimming, P. (1999) NAL/DLR-Cooperation in Aero-Propulsion. Workshop at NAL, Tokyo, Japan, 11.01.99. Volltext nicht online.

  Schimming, P. (1999) Triebwerksverdichter: Propfans. Seminarvortrag Ruhr-Universität Bochum, 23.06.99. Volltext nicht online.

  Schimming, P. (2000) Entwicklung umweltfreundlicher Triebwerke. Fachtagung der Sicherheitsingenieure -Luft- und Raumfahrt-, DLR Köln-Porz. 15.6.2000. Volltext nicht online.

  Schimming, P. (2000) Triebwerksverdichter: Propfans. Seminarvortrag, RUB Bochum, 5.07.2000. Volltext nicht online.

  Schimming, P. (2000) Triebwerksverdichter: Transsonikverdichter. Seminarvortrag, RUB, 28.06.2000. Volltext nicht online.

  Schimming, P. (1990) Aerothermodynamik von gegenlaeufigen, ummantelten Propfangeblaesen. Statusbericht der Projektgruppe Propfan bei der MTU, 10. Januar 1990, Muenchen. Volltext nicht online.

  Schimming, P. (1991) Welchen Beitrag können strömungsmechanische Untersuchungen an Verdichtern/Fans zur aerodynamischen Integration und Aeroaktustik leisten? Leistungs-, Integrations- und Aeroakustikuntersuchungen mit Modelltriebwerken, DNW/NL, 11.1191. Volltext nicht online.

  Schimming, P. (1991) 3D-Flow Analysis using Experimental and Numerical Data Received in a Ducted Propfan Rotor. DLR-ONERA-Meeting in Châtillon (F), 21./22.02.91. Volltext nicht online.

  Schimming, P. (1995) Gegenläufige ummantelte Gebläse. Kolloquium Luftfahrttechnik, Technische Hochschule Darmstadt, 10.1.1995. Volltext nicht online.

  Schimming, P. (1995) Experimentelle und numerische Ergebnisse erzielt an Turbomaschinenkomponenten. BMW Rolls-Royce, Dahlewitz bei Berlin, 29.5.1995. Volltext nicht online.

  Schimming, P. (1995) Experimentelle und numerische Ergebnisse erzielt an Turbomaschinenkomponenten. Vortrag bei ABB, Baden (Schweiz), 24.03.1995. Volltext nicht online.

  Schimming, P. (1995) Gegenläufige, ummantelte Gebläse. Seminarvortrag an der TU-Berlin, 09.06.1995. Volltext nicht online.

  Schmieder, A. (1996) Untersuchung des Einflusses der Strahlmischung auf das Betriebsverhalten von ZTL-Triebwerken. DLR-Interner Bericht. 325-12-96, 72 S. Volltext nicht online.

  Schmitt, A. und Brunner, B. und Deidewig, F. und Lecht, M. und Koehler, I. und Sausen, R. (1996) Verteilung und Auswirkung der Emissionen des zivilen Kurzstreckenverkehrs mit strahlgetriebenen Flugzeugen. Volltext nicht online.

  Schmitt, A. und Lecht, M. (1995) Emissionskataster für die Schadstoffe in der Luftfahrt. In: Systemanalyse und Technikfolgenabschätzung Campus Verlag , Frankfurt am Main. Seiten 83-93. Volltext nicht online.

  Schmitt, S. (1998) Simulation der instationären Strömung in Turbomaschinen. Kolloquium Triebwerkstechnologie, Bonn, 10.12.1998. Volltext nicht online.

  Schmitt, S. (2000) TRACE-Numerische Simulation von Strömungen in Turbomaschinen. Meeting DLR-KWU, Mülheim, 23.05.2000. Volltext nicht online.

  Schmitt, S. (2000) Erweiterung eines parallelen und zeitgenauen Navier-Stokes-Verfahrens auf aeroelastische Anwendungen. Kolloquium Energietechnik der Ruhr-Universität Bochum, Bochum, 02.02.2000. Volltext nicht online.

  Schmitt, S. (1999) Erweiterung eines parallelen und zeitgenauen Navier-Stokes-Verfahrens auf aeroelastische Anwendungen. DASA-DLR Nachwuchsinitiative, DASA-Standort Manching, 25.11.1999. Volltext nicht online.

  Schmitt, S. (1999) Experimental Data for Test Case 4. Projektbericht. BRPR-CT-97-0610, 9 S. Volltext nicht online.

  Schmitt, S. (1999) Technical Report on the NASA Rotor 37 (Test Case 2). Projektbericht. BRPR-CT97-0610, 12 S. Volltext nicht online.

  Schmitt, S. (2000) Synthesis report on the Propfan. Projektbericht. Volltext nicht online.

  Schmitt, S. (2003) Simulation von Flattern und aerodynamischer Zwangserregung in Turbomaschinenbeschaufelungen. Dissertation. DLR-Forschungsbericht. 2003-22, 186 S. Volltext nicht online.

  Schmitt, S. und Aubé, M. (2000) Synthesis of calculations performed on the contra-rotating fan from DLR. Projektbericht. Volltext nicht online.

  Schmitt, S. und Carstens, V. (2003) Numerical Simulation of Flutter and Forced Response in Turbomachines. 1st International Exhibition of Youth's Creative Work in Aerospace Technologies (UNIMAKS) on Moscow International Aviation & Space Salon, Zhukovsky/Moscow (Russia), Aug. 19-24 2003. Volltext nicht online.

  Schmitt, S. und Carstens, V. (2003) Simulation von Flattern und aerodynamischer Zwangserregung in Turbomaschinen. In: Wissenschaftliches Kolloquium &quot;Gasturbinenforschung - ein Kerngebiet des DLR&quot; zu Ehren von Prof. Winterfeld. Wissenschaftliches Kolloquium &quot;Gasturbinenforschung - ein Kerngebiet des DLR&quot; zu Ehren von Prof. Winterfeld, Köln, 15. Okt. 2003. Volltext nicht online.

  Schmitt, S. und Carstens, V. (2000) Erweiterung von TRACE-U auf aeroelastische Anwendungen. DLR-MTU Workshop zu TRACE-U, München, 20.-21.01.2000. Volltext nicht online.

  Schmitt, S. und Carstens, V. (2000) Application of Direct Fluid-Structure Coupling to a Vibrating Compressor Cascade. 2nd Int. Conference on Applied Mathematics for Industrial Flows, Tuscany, Italy, 12-14 Oct. 2000. Volltext nicht online.

  Schmitt, S. und Eulitz, F. und Nürnberger, D. und Carstens, V. (1999) Numerische Simulation schwingender Turbomachinenschaufeln durch Vorgabe harmonischer Bewegungen und durch direkte Strömung-Struktur-Kopplung. 9. AG STAB-Workshop, Göttingen, 9.-10.11.1999. Volltext nicht online.

  Schmitt, S. und Eulitz, F. und Nürnberger, D. und Carstens, V. und Belz, J. (2001) Simulation of Propfan Forced Response using a Direct Fluid-Structure Coupling Method. Proceedings 4th European Conference on Turbomachinery Fluid Dynamics and Thermodynamics, Florence, Italy, 20-23 March 2001. Volltext nicht online.

  Schmitt, S. und Eulitz, F. und Nürnberger, D. und Vogel, D.T. (2000) NASA Rotor 37 Test Case Computations. Proceedings ERCOFTAC-APPACET Seminar and Workshop on Turbomachinery Flow Prediction VIII, La Clusaz, France, 19.-23.03.2000. Volltext nicht online.

  Schmitt, S. und Eulitz, F. und Nürnberger, D. und Wallscheid, L. (2000) Comparison of propfan test case computations. Proceedings ERCOFTAC-APPACET Seminar and Workshop on Turbomachinery Flow Prediction VIII, La Clusaz, France, 19.-23.03.2000. Volltext nicht online.

  Schmitt, S. und Eulitz, F. und Nürnberger, D. und Wallscheid, L. (2000) DLR's Propfan &quot;CRISP&quot; Test Case Computations. ERCOFTAC-APPACET Seminar and Workshop on Turbomachinery Flow Prediction VIII, La Clusaz, France, 19.-23.03.2000. Volltext nicht online.

  Schmitt, S. und Eulitz, F. und Nürnberger, D. und Wallscheid, L. (2000) DLR's Counter Rotating Fan &quot;CRISP&quot; as a Testcase for the Evaluation of Unsteady Turbomachinery Flow Solvers. Proceedings ERCOFTAC-APPACET Seminar and Workshop on Turbomachinery Flow Prediction VIII, La Clusaz, France, 19.-23.03.2000. Volltext nicht online.

  Schmitt, S. und Eulitz, F. und Wallscheid, L. und Arnone, A. und Marconcine, M. (2001) Evaluation of Unsteady CFD Methods by their Application to a Transonic Propfan Stage. In: ASME Turbo Expo 2001, Seiten 1-12. The American Society of Mechanical Engineers, Atlanta, USA. ASME, International Gas Turbine & Aeroengine Congress & Exhibition, , , June 4-7, 2001, New Orleans, Louisiane, USA. Volltext nicht online.

  Schmitt, S. und Nürnberger, D. und Carstens, V. (2003) Evaluation of the Principle of Aerodynamic Superposition in Forced Response Calculations. In: Proceedings of the 10th International Symposium on Unsteady Aerodynamics, Aeroacoustics & Aeroelasticity of Turbomachines. 10th International Symposium on Unsteady Aerodynamics, Aeroacoustics & Aeroelasticity of Turbomachines, Durham (NC), Sept. 7-11 2003. Volltext nicht online.

  Schmitt, Stefan (2000) Report on Test Case 4 Computations. Projektbericht. BRPR-CT97-0610, 14 S. Volltext nicht online.

  Schmitz, G. (1996) Realisierung der Monte-Carlo-Methode zur Strahlungsberechnung auf unstrukturierten Netzen und Anwendung in einer fett-mager gestuften Brennkammer (RQL). sonstiger Bericht. Volltext nicht online.

  Schnaubelt, S. (1996) Numerische Simulation des Verhaltens und des Schadstoffausstosses von zivilen Zweistromtriebwerken im Teillastbereich. DLR-Interner Bericht. 325-04-96, 154 S. Volltext nicht online.

  Schnell, R. (2001) Experimental and Numerical Investigation of Blade Pressure Fluctuations on a CFK-Bladed Counterrotating Propfan. In: ASME Turbo Expo Land, Sea and Air 2001, Seiten 1-12. ASME Turbo Expo Land, Sea and Air, New Orleans, Louisiana, USA, June 4-7, 2001. Volltext nicht online.

  Schnell, R. (2003) Simulation des akustischen Nahfeldes einer Triebwerksgebläsestufe&quot;. Seminar für Strömungsmechanik, Berlin, 4.7.2003. Volltext nicht online.

  Schnell, R. (2004) Investigation of the Acoustic Nearfield of a Transonic-Fanstage by Time-Domain CFD-Calculations with Arbitrary Blade Counts. ASME Turbo-Expo 2004, 7.-14. Juni 2004, Wien/Österreich. Volltext nicht online.

  Schnell, R. (2004) Numerische Simulation des akustischen Nahfeldes einer Triebwerksgebläsestufe. Dissertation. DLR-Forschungsbericht. 2004-23, 132 S. Volltext nicht online.

  Schnell, R. (2005) Evaluation of the CFD-Methods elsA and TRACE by their application to Steady and Unsteady Turbine and Compressor Flows. Projektbericht, DLR-Interner Bericht. 325-15-05, 78 S. Volltext nicht online.

  Schnell, R. (1993) Kalibrierung von Fuenflochsonden zur dreidimensionalen Messung der Stroemungsgeschwindigkeit in Gasstroemungen und Auswertung von Messungen im Unterschallbereich. sonstiger Bericht. Dipl.-Arbeit, FH Köln, März 1993., 98 S. Volltext nicht online.

  Schnell, R. (1997) Erstellung eines Programmpaketes zur aerodynamischen Auslegung axialer Verdichterstufen. DLR-Interner Bericht. 325-01-97, 60 S. Volltext nicht online.

  Schnell, R. (1997) Aerodynamische Auslegung der transsonischen Fanstufe eines 7,3&quot; UHBR-Triebwerksimulators. DLR-Interner Bericht. 325-06-97, 84 S. Volltext nicht online.

  Schnell, R. und Michel, U. (2003) TurboNoiseCFD Deliverable D1.7: Report per CFD-Code: Assessment of the TRACE-Code for Noise Modelling, Summary of Work. Projektbericht. D1.7, 21 S. Volltext nicht online.

  Schnell, R. und Nürnberger, D. und Weber, A. (2004) Zeitgenaue Simulation einer 1.5-stufigen HD-Turbine mit realen Schaufelzahlen. DLR-Interner Bericht. 325-09-04, 25 S. Volltext nicht online.

  Schnell, R. und Wallscheid, L. (2001) Unsteady Blade Pressure Distributions on a Counterrotating Propfan at On- and Offdesign Conditions. In: 15th International Symposium on Air Breathing Engines, Seiten 1-10. AIAA, 1801 Alexander Bell Drive, Suite 500, Reston VA 20191-4344. 15th International Symposium on Air Breathing Engines, ISABE, Bangalore, Indien, 2.-7.9.2001. ISBN 1563475154 Volltext nicht online.

  Schnell, R. und Weber, A. (2005) CFD-Untersuchungen einer gekühlten Turbinenkonfiguration. Projektbericht, DLR-Interner Bericht. 325-06-05, 24 S. Volltext nicht online.

  Schnell, Rainer und Voges, Melanie und Mönig, Reinhard und Müller, Martin W. und Zscherp, Carsten (2008) Investigation of Blade Tip Interaction with Casing Treatment in a Transonic Compressor - Part 2: Numerical Results. In: ASME-Paper, GT2008-50212. ASME Turbo Expo 2008, 2008-06-09 - 2008-06-13, Berlin, Germany. Volltext nicht frei. file

  Schodl, R. (1998) Laser Two Focus Velocimetry: Two and Three-Dimensional Techniques. VKI Lecture Series, Brüssel, 6-9 April 1998. Volltext nicht online.

  Schodl, R. (1998) Recent Applications of Three-Dimensional Doppler-Global-Velocimetry in Turbo-Machinery. Engineering Applications of Optical Diagnostic techniques, Northamptonshire, England, 4.11.1998. Volltext nicht online.

  Schodl, R. (1998) Laser Two Focus Anemometry (3D-L2F) in Three-Dimensional Flows. Optical Techniques for Flow Diagnosis, Grasmere, UK, 27.-30.07.1998. Volltext nicht online.

  Schodl, R. (1998) First DGV-Application on a DASA Military Aircraft Model in the Low-speed Windtunnel DNW-NWB. DNW Annual Report 1996, DNW. Volltext nicht online.

  Schodl, R. (1999) Planar Quantitative Scattering Techniques for the Analysis of Mixing Processes, Shock Wave Structures and Fluid Density. In: Planar Optical Measurement Methods for Gas Turbine Components. RTO Lecture Series 217, Cranfield, UK, 16-17 Sept. 1999. Volltext nicht online.

  Schodl, R. (1999) Planar Quantitative Scattering Techniques fot the Analysis of Mixing Processes, Shock Wave Structures and Fluid Density. In: Planar Optical Measurement Methods for Gas Turbine Components. RTO Lecture Series 217, Cleveland, USA, 21-22 Sept, 1999. Volltext nicht online.

  Schodl, R. (1999) Capabilities Optical Point Measurement Techniques with Respect to Aero Engine Application. In: Planar Optical Measurement Methods for Gas Turbine Components. RTO Lecture Series 217, Cranfield, UK, 16-17 Sept, 1999. Volltext nicht online.

  Schodl, R. (1999) Capabilities of Optical Point Measurement Techniques with Respect to Aero Engine Application. In: Planar Optical Measurement Methods for Gas Turbine Components. RTO Lecture Series 217, Cleveland, USA, 21-22 Sept., 1999. Volltext nicht online.

  Schodl, R. (1999) 3D-Doppler-Global Velocimetrie als Messverfahren für Entwicklungsversuche zur Strömungsanalyse. Symposium Aktuelle Entwicklungen in der Strömungsmechanik, Graz, FH Joanneum, 10.02.99,. Volltext nicht online.

  Schodl, R. (2001) Doppler Global Velocimetry in kryogenen Windkanälen. DGLR-Fachtagung &quot;Messtechnik in kryogenen Windkanälen&quot;, TU München, Garching, 27-28 März, 2001. Volltext nicht online.

  Schodl, R. (2001) User Velocimetry for Combustor Flow Analysis. Gordon Conference: Laser Diagnostics in Combustion, Mount Holycke College, USA, 01-06 July, 2001. Volltext nicht online.

  Schodl, R. (2001) Laser Velocimetry for Combustor Flow Analysis. GORDON CONFERENCE: Laser Diagnostics in Combustion, Mount Holyoke College (USA) July 1-6, 2001.. Volltext nicht online.

  Schodl, R. (2002) Capturing the storm within engines. Magazine from the German Aerospace Center, Special Issue:&quot;Innovation is Business&quot;, Sept. 2002., Special Issue (103). Volltext nicht online.

  Schodl, R. (2003) Lasermesstechnik für Srömungen. IHK-Branchenkontakt-Workshop,DLR Köln,24 September 2003. Volltext nicht online.

  Schodl, R. (1990) Das Laser-Zwei-Fokus-Strömungsgeschwindigkeitsmeßverfahren und seine Anwendung in der Strömungsmaschinenforschung. Seminarreihe &quot;Meßtechnische Anwendungen in der Strömungsmaschinenforschung&quot;, 24. Januar 1990, RWTH Aachen. Volltext nicht online.

  Schodl, R. (1990) Laser Two Focus Velocimetry. Carleton University, Ottawa, Canada, 19 September 1990.. Volltext nicht online.

  Schodl, R. (1990) Laser Velocimetry. National Research Council, Ottawa, Canada, 18 September 1990.. Volltext nicht online.

  Schodl, R. (1990) New Development of the Laser Two Focus Technique. Vortrag bei Pratt & Whitney, Montreal, Kanada, am 20. September 1990. Volltext nicht online.

  Schodl, R. (1991) Laser transit velocimetry. In: &quot;Laser Velocimetry&quot; VKI Lecture Series 1991-8. Volltext nicht online.

  Schodl, R. (1991) Geschwindigkeitsmessung in Turbomaschinen. Presse-Lasertag, DLR-Stuttgart, 14.05.1991. Volltext nicht online.

  Schodl, R. (1992) Das Laser-Zwei-Fokus-Stroemungsgeschwindigkeitsmeverfahren- Prinzip, Anwendungsbeispiele, neue Entwicklungen. Seminarvortrag am 08.05.92 am Inst. fuer Fluid- und Thermodynamik, Universitaet-GH-Siegen. Volltext nicht online.

  Schodl, R. (1994) Einfuehrung in das Laser-Zwei-Fokus-Verfahren. Vortrag:&quot;Laser Anemometry&quot; Universitaet Karlsruhe, 10.-11.Mai 1994. Volltext nicht online.

  Schodl, R. (1994) Experimentelle Untersuchung zur Expansionsstroemung nach Wasserstoff/Luft-Verbrennung in luftatmenden Hyperschallantrieben. Workshop &quot;Entwicklung und Einsatz von Stroemungsmessverfahren&quot;zum SFB &quot;Grundlagen fuer den Hyperschallflug&quot;. Volltext nicht online.

  Schodl, R. (1994) Application of Laser measurement techniques at TsAGI-Report on the different measurement campaigns. 3rd Working Group meeting &quot;Scramjet Technology&quot;. Volltext nicht online.

  Schodl, R. (1995) Laser-2-Fokus Velocimeter, Grundlagen, Anwendungen und neue Entwicklungen. Workshop &quot;Laser Velocimetrie&quot;, Fa. Polytec, Waldbronn, 16/17.03.95. Volltext nicht online.

  Schodl, R. (1995) Einführung in die Laser-Zwei-Fokus (L2F)-Velocimetrie. &quot;LASER ANEMOMETRY&quot;, Universität Karlsruhe (TH), 23./24. Mai 1995. Volltext nicht online.

  Schodl, R. (1999) Laser-Zwei-Fokus Geschwindigkeitsmessverfahren, Grundlagen und Anwendungen. Strömungsmesstechnik in der industriellen Forschung, Darmstadt, 11.-14. Okt. 1999. Volltext nicht online.

  Schodl, R. und Foerster, W. (1991) New development in the laser-2-fokus technique for non-intrusive velocity measurements in gasturbine components. In: Journal de Physique III, Turbomachines Issue, Dec. 1991. Volltext nicht online.

  Schodl, R. und Foerster, W. (1991) Geschwindigkeitsmessung in Turbomaschinen. DLR-Nachrichten, 63, Seiten 12-18. Volltext nicht online.

  Schodl, R. und Foerster, W. und Beversdorff, M. und Klemmer, T. und Rymenants, E. (1991) Development of 3D-velocimeters based on the laser-2-focus technique. In: Fourth International Conference on Laser Anemometry Advance and Applications. Cleveland Ohio, USA, 05.-09.08.91. Volltext nicht online.

  Schodl, R. und Förster, W. (1991) Multicolor fiberoptic Laser-Two-Focus velocimeter for three-dimensional flow analysis. AIAA Journal, 29, Seiten 1290-1297. Volltext nicht online.

  Schodl, R. und Förster, W. und Beversdorff, M. (1995) Neue Entwicklungen beim L2F-Verfahren. In: Lasermethoden in der Strömungsmeßtechnik Berichte aus der Lasermeßtechnik. Verlag Shaker, Aachen. 5S.-. Volltext nicht online.

  Schodl, R. und Förster, W. und Beversdorff, M. (1995) Neue Entwicklungen beim L2F-Verfahren. 4. Fachtagung - GALA &quot;Lasermethoden in der Strömungsmeßtechnik&quot;, Rostock, 12.-14.09.1995. Volltext nicht online.

  Schodl, R. und Förster, W. und Karpinski, G. und Krain, H. und Röhle, I. (2000) 3-Component Doppler Laser-Two-Focus Velocimetry Applied to a Transonic Centrifugal Compressor. 10th International Symp. on Application of Laser Techniques to Fluid Mechanics, Lisbon, Portugal, July 2000, Paper 7-2. Volltext nicht online.

  Schodl, R. und Förster, W. und Karpinsky, G. und Krain, H. und Röhle, I. (2001) 3-component Doppler Laser-Two-Focus Velocimetry Applied to a Transonic Centrifugal Compressor. In: &quot;Laser Techniques for Fluid Mechanics&quot; Selected papers form the 10th International Symp., Lisbon, Portugal Springer. Volltext nicht online.

  Schodl, R. und Roehle, I. (1995) Neue Entwicklungen beim Doppler-Global-Verfahren. In: Lasermethoden in der Strömungsmeßtechnik. Verlag Shaker, Aachen 1995. Lasermethoden in der Strömungsmeßtechnik, Rostock, 12.-14. September 1995. Volltext nicht online.

  Schodl, R. und Röhle, I. (1995) Neue Entwicklungen beim Doppler-Global-Verfahren. 4. Fachtagung - GALA &quot;Lasermethoden in der Strömungsmeßtechnik&quot;, Rostock, 12.-14.09.1995. Volltext nicht online.

  Schodl, R. und Röhle, I. (1996) Doppler Global Velocimetry in the Flow of a Swirler. Vortrag im Rahmen NASA-DLR Kooperation Task 12, 6. Juni 1996, NASA Lewis RC, Cleveland, USA. Volltext nicht online.

  Schodl, R. und Röhle, I. (1996) Doppler-Global-Velocimetry in der Stroemung einer Drallduese. XXVIII Kraftwerkstechnisches Kolloquium, 6. Kolloquium Meßtechnik für Energieanlagen, 29/30. Okt. 1996, Dresden. Volltext nicht online.

  Schodl, R. und Röhle, I. und Willert, C. und Fischer, M. und Heinze, J. und Laible, C. und Schilling, T. (2002) Doppler Global Velocimetry for the analysis of combustor flow. Aerospace Science and Technology, 6 (7), Seiten 481-493. Volltext nicht online.

  Schodl, R. und Willert, C. und Roehle, I. und Heinze, J. und Foerster, W. und Fischer, M. und Beversdorff, M. (2002) Optical Diagnostic Techniques in Turbomachinery. 22nd AIAA Aerodynamic Measurement Technology and Ground Testing Conference, St. Louis, Missouri, USA, June 24-27, 2002.. Volltext nicht online.

  Schodl, R. und Willert, C. und Röhle, I. und Beversdorff, M. und Blümcke, E.W. (2000) Flächige Strömungsgeschwindigkeitsmessung in Motorkomponenten mit der Doppler Global Velocimetrie. Optisches Indizieren - Verbrennungsentwicklung für Otto-Dieselmotoren, Esse, Haus der Technik, 26. Sept. 2000. Volltext nicht online.

  Schodl, Richard (2005) Doppler-L2F zur 3-Komponenten-Geschwindigkeitsmessung in Turbomaschinen. Expertenkreis Messtechnik,München,25/26 Januar 2005. Volltext nicht online.

  Schodl, Richard (2005) Laser transit velocimetry. In: Springer Handbook of Experimental Fluid Mechanics Springer Verlag. 3.3.4. ISBN 978-3-540-25141-5. Volltext nicht online.

  Schreiber, H. A. (1990) Verdichtungsstoesse und Stossgrenzschicht-Wechselwirkung in transsonischen und supersonischen Verdichtungsgittern. Seminarvortrag am Institut fuer Stroemungslehre und Stroemungsmaschin en der Universitaet Karlsruhe, 18. Januar 1990. Volltext nicht online.

  Schreiber, H. A. (1990) Entwurfsgrundlagen fuer transsonische und supersonische Verzoegerungsgitter. Kolloquium Energietechnik an der Ruhr-Universitaet Bochum, 7. Februar 1990.. Volltext nicht online.

  Schreiber, H. A. (1990) Starke Stoß-Grenzschicht-Wechselwirkung in einem Überschallverdichtergitter. 7. DGLR-Fachsymposium &quot;Strömungen mit Ablösung&quot; (STAB) in Aachen, 7.-9. November 1990. Volltext nicht online.

  Schreiber, H. A. (1990) Determination of the Inlet Flow Angle in Tests of Supercritical Cascades. Gas Turbine Establishment (GTE) in Jiangjou, PR China, 16 October 199 0. Volltext nicht online.

  Schreiber, H. A. (1990) Design of a Transonic Compressor Cascade and Study of Shock-Wave/Boundary Layer Interaction. 1) Institute of Thermophysics, Academia Sinica, Bejing, PR China, 10 October 1990; 2) Gas Turbine Establishment (GTE), Jiangyon, PR Chi na, 17 October 1990. Volltext nicht online.

  Schreiber, H. A. und Fuchs, R. (1994) Entwicklung einer Entwurfsmethode fuer transsonische Axialverdichtergitter. Posterbeitrag TURBOTECH AK-Sitzung, Köln 10.11.94. Volltext nicht online.

  Schreiber, H. A. und Steinert, W. (2004) Experimental Investigation of Two Outlet Guide Vane Cascades - Effect of Free-Stream Turbulence on OGV-BASE and OGV-ES and Endwall Performance of the OGV-ES Cascade Part I: Effect of Free-Stream Turbulence. Projektbericht, DLR-Interner Bericht. DLR IB 325 - 06 -04-1. Volltext nicht online.

  Schreiber, H. A. und Steinert, W. (2003) Transsonische Profile für eine Frontstufe - Siemens TGG-101 und TGG-104 - Numerische und experimentelle Untersuchungen bei M1 = 0.8 - 1.12. Projektbericht, DLR-Interner Bericht. IB 325 - 10 - 03, 114 S. Volltext nicht online.

  Schreiber, H. A. und Steinert, W. (2002) Experimental Investigation of Two Exit Guide Vane Cascades Optimized for Operation at Low Reynolds Numbers - ES-OGV-10 and OGV-MOGA-138. Projektbericht, DLR-Interner Bericht. DLR IB - 325-03-02, 425 S. Volltext nicht online.

  Schreiber, H. A. und Steinert, W. (2004) Experimental Investigation of Two Outlet Guide Vane Cascades - Effect Of Free-Stream Turbulence on OGV-BASE and OGV-ES and Enwall Performance of the OGV-ES Cascade, Part II: End-wall Performance of Outlet Guide Vane. Projektbericht, DLR-Interner Bericht. DLR IB-325-06-04 Part II, 75 S. Volltext nicht online.

  Schreiber, H. A. und Steinert, W. und Küsters, B. (2002) Effects of Reynolds Number and Free-Stream Turbulence on Boundary Layer Transition in a Compressor Cascade - 2000 Heat Transfer Commitee Best Paper. ASME Journal of Turbomachinery, Vol. 124, Janurary 2002, Seiten 1-9. Volltext nicht online.

  Schreiber, H. A. und Steinert, W. und Sonoda, T. und Arima, T. (2004) Advanced High-Turning Compressor Airfoils for Low Reynolds Number Condition - Part II: Experimental and Numerical Analysis. ASME Journal of Turbomachinery, Vol. 126, October 2004, Seiten 482-492. Volltext nicht online.

  Schreiber, H. A. und Steinert, W. und Sonoda, T. und Arima, T. (2003) Advanced High-Turning Compressor Airfoils for Low Reynolds Number Condition - Part II: Experimental and Numerical Analysis. In: ASME Turbo Expo 2003, Atlanta, June 16-19. International Gasd Turbine and Aero Engine Congress, Atlanta, June 16-19, 2003. Volltext nicht online.

  Schreiber, H.-A. (1999) Strömung in transsonischen und supersonischen Verdichterbeschaufelungen. Seminar Thermische Energietechnik, Universität Kassel, 24. 06.1999. Volltext nicht online.

  Schreiber, H.-A. (1999) Development of Advanced Compressor Airfoils for Heavy-Duty Gas Turbines. Part II: Experimental and Theoretical Analysis. ASME Gas Turbine and Aeroengine Technical Congress, Indianapolis, June 7-10, 1999. Volltext nicht online.

  Schreiber, H.-A. (1991) Experimentelle Untersuchungen an zwei Überschall-Verdichtergittern für den HYPER-CRISP Rotor 2 Rotormittelschnitt CR-52-1, Gehäuseschnitt CR52-2. DLR-Interner Bericht. 325-06-91, 137 S. Volltext nicht online.

  Schreiber, H.-A. (1991) Shock Losses in Compressor Cascade. Vortrag am Aero Gas Turbine Research Institute (AGTRI) in Jiangyou Sichuan, China, 20.11.91. Volltext nicht online.

  Schreiber, H.-A. (1991) Design, theoretical, and experimental analysis of a supercritical compressor cascade. Vortrag am Aero Gas Turbine Research Institute (AGTRI) in Jiangyou Sichuan, China, 15.11.91. Volltext nicht online.

  Schreiber, H.-A. (1991) Starke Stoß-Grenzschicht-Wechselwirkung in einem Überschall-Verdichtergitter. sonstiger Bericht. 90-06 Volltext nicht online.

  Schreiber, H.-A. (1995) Shock-Wave Turbulent Boundary Layer Interaction in a Highly Loaded Transonic Fan Blade Cascade. 85th AGARD-PEP Symposium on &quot;Loss Mechanisms and Unsteady Flows in Turbomachines&quot;, May 8-12, 1995, Derby, UK, paper No. 17. Volltext nicht online.

  Schreiber, H.-A. und Küsters, B. und Steinert, W. (1998) Experimentelle und numerische Untersuchung des Gasturbinen-Verdichtergitters KWU-HPA-32/093. DLR-Interner Bericht. 325-5-98. Volltext nicht online.

  Schreiber, H.-A. und Küsters, B. und Steinert, W. (1998) Experimentelle und numerische Untersuchung des Gasturbinen-Verdichtergitters KWU HPA-16/050. DLR-Interner Bericht. 325-07-98. Volltext nicht online.

  Schreiber, H.-A. und Starken, H. (1991) An investigation of a strong shock-wave turbulent boundary layer interaction in a supersonic compressor cascade. presented at the International Gas Turbine and Aeroengine Congress, Orlande (USA), 03.-06.06.91. Volltext nicht online.

  Schreiber, H.-A. und Steinert, W. und Küsters, B. (1998) Untersuchungen zum Einfluß der Re-Zahl und des Turbulenzgrades auf die Grenzschichttransitition im Verdichtergitter. DLR-Interner Bericht. 325-08-98. Volltext nicht online.

  Schreiber, H.-A. und Steinert, W. und Küsters, B. (2000) Effects of Reynolds Number and free-stream Turbulence on Boundary Layer Transition in a Compressor Cascade. International Gas Turbine and Aeroengine Technical Congress, München, Germany, 8.-11. May, 2000. Volltext nicht online.

  Schreiber, H.A. (2000) Flows in 2- and 3-dimensional Transonic Compressor Cascades. NAL-DLR Workshop on Experimental Fluid Mechanics and Turbomachinery, Bangalore, India, 10.-12. Jan. 2000. Volltext nicht online.

  Schreiber, H.A. (2000) Design Considerations for Compressor Blade Sections. NAL-DLR Workshop on Experimental Fluid Mechanics and Turbomachinery, Bangalore, India, 10.-12. Jan. 2000. Volltext nicht online.

  Schreiber, H.A. (2000) Turbomachinery Research-DLR Cologne. NAL-DLR Workshop on Experimental Fluid Mechanics and Turbomachinery, Bangalore, India,10.-12. Jan. 2000. Volltext nicht online.

  Schreiber, H.A. (2000) Verdichterprofile für transsonische Strömungen - Status. Vortrag bei Siemens Power Generation, Mülheim/Ruhr, 12.12.2000. Volltext nicht online.

  Schreiber, H.A. (1993) Transsonische Stroemungen in Verdichtergittern. Kolloquium Institut f. Antriebstechnik, DLR in Koeln-Porz, 20.01.93. Volltext nicht online.

  Schreiber, H.A. (1993) Untersuchung der turbulenten Stoss-Grenzschicht-Wechselwirkung in einem Ueberschallverdichtergitter mit Abloesung. Vortrag 6. STAB Workshop 10.-12.Nov.93 in Goettingen. Volltext nicht online.

  Schreiber, H.A. (1994) Verdichtergitter mit 'pre-compression' Profilierung. Vortrag MTU-Muenchen, 08.06.1994. Volltext nicht online.

  Schreiber, H.A. (1994) Stroemung in hochbelasteten Ueberschall-Verdichtergittern. Kolloquium Energietechnik, 21.12.94, Ruhr-Universitaet Bochum. Volltext nicht online.

  Schreiber, H.A. (1995) Forschungsarbeiten auf dem Gebiet der transsonischen Verdichterbeschaufelung. BMW Rolls-Royce, Dahlewitz bei Berlin, 29.05.1995. Volltext nicht online.

  Schreiber, H.A. (1995) Transonic Shock Wave Boundary Layer Interaction in Compressor Cascades. DLR-ONERA Workshop, ONERA-CERT, Toulouse, 14.11.1995. Volltext nicht online.

  Schreiber, H.A. (1996) Experimentelle Untersuchung der KWU-Verdichterprofile HPA 28/08 und HPA 17/06. Vortrag bei Siemens AG / KWU in Mülheim/Ruhr, 2. Juli 1996. Volltext nicht online.

  Schreiber, H.A. (1997) Recent activities in transonic compressor cascade research. Besuch von Karman Institut, DLR Koeln, 17.06.97. Volltext nicht online.

  Schreiber, H.A. und Fuchs, R. (1993) Entwurfsgrundlagen fuer transsonische Axialverdichtergitter. Posterpraesentation zur Arbeitskreissitzung AG-Turbo-TURBOTECH Koeln 15.-16.03.1993. Volltext nicht online.

  Schreiber, H.A. und Fuchs, R. und Weber, A. und Steinert, W. (2001) Räumliche Strömung in transsonischen Verdichtergittern sehr hoher Belastung. In: Siebtes Statusseminar, Verbundprojekt Hochtemperatur Gasturbine,Verbundprojekt CO2-armes Kraftwerk - 500 MW auf einer Welle, 2-1-2-15. 7. Statusseminar der AG TURBO, Verbundprojekt der Hochtemperatur-Gasturbine, Köln, 7.-8.12.2000. Volltext nicht online.

  Schreiber, H.A. und Herzke, J. (1993) Dreidimensionale Stoss-Wandgrenzschicht-Interferenz im Eintrittsbereich von transsonischen Verdichterschaufeln. DGLR-Fachausschussitzung &quot;Dreidimensionale reibungsbehaftete Stroemung in Turbomaschinen, 29./30.04.93 in Stuttgart. Volltext nicht online.

  Schreiber, H.A. und Kuesters, B. (1997) Numerical Simulation of Compressor Cascade Flow with Strong Shock-Wave Boundary Layer Interaction. Joint Propulsion Conference and Exhibit, Seattle, WA, 6-9, July, 1997. Volltext nicht online.

  Schreiber, H.A. und Küsters, B. (1997) Numerische Simulation der Strömung in einem supersonischen Verdichtergitter mit starker Stoß-Grenzschicht-Interferenz. 8. STAB Workshop, Göttingen, 11.-12. Nov. 1997. Volltext nicht online.

  Schreiber, H.A. und Küsters, B. und Steinert, W. (1998) Experimentelle und numerische Untersuchung des Gasturbinengitters KWU-HPA-26/074. Projektbericht, DLR-Interner Bericht. 325-05-98. Volltext nicht online.

  Schreiber, H.A. und Starken, H. und Steinert, W. (1993) Transonic and Supersonic Cascades; in AGARDOgraph 328 on Advanced Methods for Cascade Testing. In: AGARDograph AGARDOgraph Advanced Methods for Cascade Testingascade Testing, 328 . Seiten 35-72. Volltext nicht online.

  Schreiber, H.A. und Steinert, W. (2001) Experimental Investigation of the Exit Guid Vane Cascade OGV-CDA at Different Reynolds- and Mach numbers. DLR-Interner Bericht. 325-04-01, 205 S. Volltext nicht online.

  Schreiber, H.A. und Steinert, W. (2001) Untersuchungen zum Einfluss der Profildruckverteilung und der Vorderkantengeometrie auf die aerodynamischen Beiwerte von Verdichtergittern. Projektbericht, DLR-Interner Bericht. Datenbericht. Volltext nicht online.

  Schreiber, H.A. und Steinert, W. und Kuesters, B. (1997) Zum Einfluss der Re-Zahl und des Turbulenzgrades auf die Grenzschichttransition. Statusseminar DLR-KWU Kooperation, 19.12.1997, Muelheim/Ruhr. Volltext nicht online.

  Schreiber, H.A. und Steinert, W. und Kuesters, B. (1997) Untersuchung von vier Unterschall-Verdichterprofilen aus der HPA-Systematik. Statusseminar DLR-KWU Kooperation, 19.12.1997, Muelheim/Ruhr. Volltext nicht online.

  Schreiber, H.A. und Weber, A. und Fuchs, R. und Steinert, W. (2001) 3D Transonic Flow in a Compressor Cascade with Shock-Induced Corner Stall. The 46th ASME International Gas Turbine & Aeroengine Technical Congress, New Orleans, USA, June 4-7, 2001. Volltext nicht online.

  Schreiber, H.A. und Starken, H. (1992) An Investigation of a Strong Shock-Wave Turbulent Boundary Layer Interaction in a Supersonic Compressor Cascade. Transaction of the ASME, Journal of Turbomachinery July 1992, Vol.14, pp.494-503, Seiten 949-503. Volltext nicht online.

  Schreiber, H.A. und Steinert, W. und Starken, H. (1992) Investigation of a Cascade with Controlled Duffusion Airfoils Designed for an Inlet Mach Number of 0.92. DLR-Interner Bericht. 325-06-92, 102 S. Volltext nicht online.

  Schröder, Andreas und Agocs, Janos und Geisler, Reinhard und Heider, André und Politz, Christina und Boden, Fritz und Konrath, Robert und Roosenboom, Eric und Willert, Christian und Kompenhans, Jürgen und Wieneke, Bernd und Michaelis, Dirk und Elsinga, Gerrit E. und Scarano, Fulvio und Poelma, Christian und Westerweel, Jerry (2009) Developments for Industrial PIV. Symposium 25 Years of PIV in aerodynamics, 23.-25. Sept. 2009, Göttingen, Germany. Volltext nicht online.

  Schröder, Andreas und Agocs, Janos und Geisler, Reinhard und Heider, André und Politz, Christina und Boden, Fritz und Konrath, Robert und Roosenboom, Eric und Willert, Christian und Kompenhans, Jürgen und Wieneke, Bernhard und Michaelis, Dirk und Elsinga, Gerrit und Scarano, Fulvio und Poelma, Christian und Westerweel, Jerry (2010) Developments of PIV in Aerodynamics. Internationale Physik Olympiade , 23. - 29. Januar 2010, Göttingen, Germany. Volltext nicht online.

  Schröder, Andreas und Geisler, Reinhard und Agocs, Janos und Heider, André und Roosenboom, Eric und Herr, Michaela und Konrath, Robert und Willert, Christian und Kompenhans, Jürgen und Wieneke, Bernhard und Dierksheide, Uwe und Elsinga, Gerit E. und Scarano, Fulvio und Poelma, Christian (2009) Particle Image Velocimetry (PIV) - Grundlagen der Messtechnik und Anwendungen in der Aerodynamikforschung. Seminar für Strömungstechnik, 16.06.2009, München, Deutschland. Volltext nicht online.

  Schröder, Andreas und Geisler, Reinhard und Agocs, Janos und Heider, André und Roosenboom, Eric und Herr, Michaela und Konrath, Robert und Willert, Christian und Kompenhans, Jürgen und Wieneke, Bernhard und Dierksheide, Uwe und Elsinga, Gerit E. und Scarano, Fulvio und Poelma, Christian (2009) Particle Image Velocimetry (PIV) - Grundlagen der Messtechnik und Anwendungen in der Aerodynamikforschung. Optische Messtechnik, 22.06.2009, Darmstadt, Deutschland. Volltext nicht online.

  Schröder, Andreas und Geisler, Reinhard und Agocs, Janos und Heider, André und Roosenboom, Eric und Herr, Michaela und Konrath, Robert und Willert, Christian und Kompenhans, Jürgen und Wieneke, Bernhard und Dierksheide, Uwe und Elsinga, Gerrit und Scarano, Fulvio und Poelma, Christian (2009) Applications of Particle Image Velocimetry to industrial aerodynamic research. JMBC Course Particle Image Velocimetry, 26.-30.10.2009, Delft, The Netherlands. Volltext nicht online.

  Schubert, S. und Neumann, S. O. und Weigand, B. und Elfert, M. und Jarius, M. und Hoevel, H. (2002) Optimierung von rotierenden Multipass-Kühlsystemen. 8. Statusseminar AG-TURBO: Verbundprojekt für ein CO2-armes Kraftwerk &quot;500 MW auf einer Welle&quot;, Köln, 5./6. Dez, 2002. Volltext nicht online.

  Schubert, S. und Neumann, S.O. und Jarius, M. und Elfert, M. und Weigand, B. (2003) Investigation of flow phenomena and heat transfer performance of a ribbed two-pass cooling channel with turbine typical cross sections. In: Proceedings. 16th Intern.Symp. on Air Breathing Engines,Aug.31-Sept.5,2003,Cleveland,Ohio,USA. Volltext nicht online.

  Schuetz, H. und Eickhoff, H. und Theisen, P. und Griebel, P. und Koopman, J. (1997) Analysis of the Mixing Zone of an Air Staged Combustor. In: Proc. XIII ISABE 1997. XIII ISABE, Chattanooga, USA, 1997. Volltext nicht online.

  Schuetz, H. und Muehleck, P. (1993) Numerical Study of the Reactive Flow in a H2-Fueled Ramjet. In: Procs.: Sciences et Defense 1993, Vouvelles Acancees Scienfifiques at Techniques. Entretiens Science et Defense 1993, Paris 11.-12. Mai 1993. Volltext nicht online.

  Schulze, R. (1993) Theoretical Examination of the Behaviour of Seed Particles in Turbulent Flow Fields with Strong Accelerations. Diplomarbeit. Volltext nicht online.

  Schwarz, C. und Brandt, H. und Fottner, L. und Stockhausen, G. und Beversdorff, M. und Schodl, R. (2003) Doppler Global Velocimetry Messungen im Verteilerkanal eines typischen Abblase-Luftsystem für mehrstufige Axialverdichter. In: Lasermethoden in der Strömungsmesstechnik, 32.1-32.9. Lasermethoden in der Strömungsmesstechnik, Braunschweig, 9-11.9.2003. ISBN 3-00-011903-5 Volltext nicht online.

  Schäfer, Philipp und Cierpka, Christian und Rehder, Hans-Jürgen und Röhle, Ingo (2011) Wavelet analysis of vortical structures in turbomachinery applied to PIV data. ASME Turbo Expo 2011, 6.-10.Juni 2011, Vancouver, Kanada. Volltext nicht online.

  Schäfer, Philipp und Giess, P.-A. und Finzel, Conrad und Hofmann, Willy (2014) Verbesserung des Druckrückgewinns in axialen Kraftwerksdiffusoren. In: Tagungsband AGTurbo Statusseminar. AGTurbo Programmleitung. AGTurbo Statusseminar, 8. - 9. Dez. 2014, DLR Köln, Deutschland. Volltext nicht online.

  Schäfer, Philipp und Gieß, P.-A. und Finzel, Conrad und Hofmann, Willy (2014) Verbesserung des Druckrückgewinns in axialen Kraftwerksdiffusoren. Projektbericht. Volltext nicht online.

  Schönweitz, Dirk und Becker, Richard-Gregor und Schnell, Rainer und Schroll, Michael und Ebel, Paul-Benjamin (2016) Aerodynamic Performance Characteristics of the Installe V2527 Fan at Ground Operation. 54th AIAA Aerospace Sciences Meeting, 04.-08. Jan. 2016, San Diego, USA. DOI: 10.2514/6.2016-0111 Volltext nicht online.

  Seelhorst, U. und Lehmann, B. und Weiland, M. und Sauerland, K.H. und Bütefisch, K. A. (1995) Strömunsfeldmessungen im Klappensystem einer Hochauftriebskonfiguration mittels 3-Komponenten-Laser-Doppler-Anemometer. DLR-Interner Bericht. 223 - 94 C 57, 22 S. Volltext nicht online.

  Seifert, M. und Heinze, J. und Schodl, R. (2003) Bau einer Kalibriervorrichtung für Absorptionsfilterkennlinien von Jodzellen für die Doppler Global Velocimetry. In: Lasermethoden in der Strömungsmeßtechnik, 11, 33.1-33.6. GALA, September 2003, Rostock. ISBN 3-00-011903-5 Volltext nicht online.

  Semidetnov, N. (1995) Theoretical and experimental study of time-of-flight anemometer as particle sizing in instrument. DLR-Interner Bericht. 325-04-95, 114 S. Volltext nicht online.

  Seum, Stefan und Heinrichs, Matthias und Henning, Arne und Hepting, Michael und Keimel, Hermann und Matthias, Volker und Müller, Stephan und Neumann, Thorsten und Özdemir, Enver Doruk und Plohr, Martin und Pregger, Thomas und Sanok, Sandra und Sausen, Robert und Seebach, Oliver und Vogel, Bernhard und Winkler, Christian (2015) The DLR VEU-Project Transport and the Environment - building competency for a sustainable mobility future. 4th Conference on Transport, Atmosphere and Climate, TAC-4, 22.-25.06.2015, Bad Kohlgrub, Deutschland. Volltext nicht online.

  Sippel, M. und Sodomann, M. und Deidewig, F. (1995) Evaluation of High Speed Turbojet/Turbofan Engine Concepts on the Performance of the DSL STS-Booster-Stage. In: AIAA-paper: 95-2750. American Inst. of Aeronautics and Astronautics Washington D.C.. 31st Joint Propulsion Conference, San Diego, CA, USA. Volltext nicht online.

  Slemr, F. und Giehl, H. und Habram, M. und Slemr, J. und Schlager, H. und Schulte, P. und Haschberger, Peter und Lindermeir, Erwin und Döpelheuer, A. und Plohr, M. (2001) In-Flight Measurement of Aircraft CO and Nonmethane Hydrocarbon Emission Indices. Journal of Geophysical Research, 106 (D7), Seiten 7485-7494. Volltext nicht online.

  Sonoda, T. und Arima, T. und Olhofer, M. und Sendhoff, B. und Kost, F. und Gieß, P.-A. (2004) A Study of Advanced High Loaded Transonic Turbine Airfoils. In: Poceedings of ASME Turbo Expo 2004 Power for Land, Sea and Air, GT2004-53773. ASME Turbo Expo 2004, Vienna, Austria, 14-17 June 2004, Austria. Volltext nicht online.

  Sonoda, T. und Yamaguchi, Y. und Arima, T. und Olhofer, M. und Sendhoff, B. und Schreiber, H. A. (2004) Advanced High Turning Compressor Airfoils for Low Reynolds Number Condition - Part I: Design and Optimization. ASME Journal of Turbomachinery, Vol. 126, July 2004, Seiten 350-359. Volltext nicht online.

  Sonoda, T. und Yamaguchi, Y. und Arima,, und Olhofer, M. und Sendhoff, B. und Schreiber, H. A. (2003) Advanced High Turning Compressor Airfoils for Low Reynolds Number Conditrion - Part I: Design and Optimization. In: ASME Turbo Expo 2003. International Gas Turbine and Aero Engine Congress, Atlanta, GA, June 16-19, 2003. Volltext nicht online.

  Stanislas, Michel und Hinsch, KLaus und Westerweel, Jerry und Willert, CHristian und Ehrenfried, KLaus und Kompenhans, Jürgen und Schröder, Andreas und Raffel, Markus und Kähler, Christian und Bao, Feng und Klinge, Falk und Konrath, Robert und Sammler, Bernd und Stasicki, Boleslaw und Agocs, Janos und Frahnert, Holger und Vollmers, Heinrich und Christou, K. und Mattner, Hartmut und Micknaus, Ilka und Rosenstock, Catrin und Henze, Doris (2004) Application of Particle Image Velocimetry -Theory and Practice -, Course Notes. Volltext nicht online.

  Stanislas, Michel und Hinsch, Klaus und Poelma, Christian und Willert, Christian und Kähler, Christian und Ehrenfried, Klaus und Raffel, Markus und Geisler, Reinhard und Kompenhans, Jürgen und Schröder, Andreas und Stasicki, Boleslaw und Agocs, Janos und Boden, Fritz und Frahnert, Holger und Heider, André und Henning, Arne und Kirmse, Tania und Mattner, Hartmut und Otter, Dirk und Micknaus, Ilka und Rosenstock, Catrin und Micknaus, Jennifer und Mattner, Alexandra (2007) Application of Particle Image Velocimetry -Theory and Practice- Course Notes. Course Notes, Ordner. Volltext nicht online.

  Stanislas, Michel und Hinsch, Klaus und Westerweel, Jerry und Kähler, Christian und Raffel, Markus und Poelma, Christian und Willert, Christian und Ehrenfried, Klaus und Geisler, Reinhard und Stasicki, Boleslaw und Kompenhans, Jürgen und Schröder, Andreas und Schanz, Daniel und Gesemann, Sebastian und Agocs, Janos und Roosenboom, Eric und Boden, Fritz und Kirmse, Tania und Krebs, Ingo und Mattner, Hartmut und Otter, Dirk und Zani, Xhevahire und Rosenstock, Catrin und Micknaus, Ilka (2010) Application of Particle Image Velocimetry -Theory and Practice- Course Notes. Course Notes, Ordner. Volltext nicht online.

  Stanislas, Michel und Hinsch, Klaus und Westerweel, Jerry und Kähler, Christian und Raffel, Markus und Poelma, Christian und Willert, Christian und Ehrenfried, Klaus und Geisler, Reinhard und Stasicki, Boleslaw und Kompenhans, Jürgen und Schröder, Andreas und Schanz, Daniel und Gesemann, Sebastian und Agocs, Janos und Roosenboom, Eric und Kirmse, Tania und Krebs, Ingo und Mattner, Hartmut und Otter, Dirk und Rosenstock, Catrin und Micknaus, Ilka (2011) Application of Particle Image Velocimetry -Theory and Practice- Course Notes. Course Notes, Ordner. Volltext nicht online.

  Stanislas, Michel und Hinsch, Klaus und Westerweel, Jerry und Kähler, Christian und Raffel, Markus und Poelma, Christian und Willert, Christian und Ehrenfried, Klaus und Geisler, Reinhard und Stasicki, Boleslaw und Koop, Lars und Schröder, Andreas und Schanz, Daniel und Gesemann, Sebastian und Agocs, Janos und Roosenboom, Eric und Kompenhans, Jürgen und Mattner, Hartmut und Otter, Dirk und Rosenstock, Catrin und Micknaus, Ilka und Wrede, Björn (2012) Application of Particle Image Velocimetry -Theory and Practice- Course Notes. Course Notes, Ordner. Volltext nicht online.

  Stanislas, Michel und Hinsch, Klaus und Westerweel, Jerry und Kähler, Christian und Raffel, Markus und Poelma, Christian und Willert, Christian und Ehrenfried, Klaus und Geisler, Reinhard und Kompenhans, Jürgen und Schröder, Andreas und Stasicki, Boleslaw und Schanz, Daniel und Agocs, Janos und Roosenboom, Eric und Boden, Fritz und Kirmse, Tania und Zani, Xhevahire und Mattner, Hartmut und Otter, Dirk und Aue, Reneé und Micknaus, Ilka und Rosenstock, Catrin und Micknaus, Jennifer (2009) Application of Particle Image Velocimetry -Theory and Practice- Course Notes. Course Notes, Ordner. Volltext nicht online.

  Stanislas, Michel und Hinsch, Klaus und Westerweel, Jerry und Poelma, Christian und Willert, Christian und Kähler, Christian und Ehrenfried, Klaus und Raffel, Markus und Geisler, Reinhard und Kompenhans, Jürgen und Schröder, Andreas und Stasicki, Boleslaw und Agocs, Janos und Boden, Fritz und Heider, André und Henning, Arne und Kirmse, Tania und Mattner, Hartmut und Otter, Dirk und Micknaus, Ilka und Rosenstock, Catrin und Micknaus, Jennifer (2008) Application of Particle Image Velocimetry -Theory and Practice- Course Notes. Course Notes, Ordner. Volltext nicht online.

  Stanislas, Michel und Hinsch, Klaus und Westerweel, Jerry und Willert, Christian und Kähler, Christian und Ehrenfried, Klaus und Raffel, Markus und Kompenhans, Jürgen und Schröder, Andreas und Klinge, Falk und Konrath, Robert und Stasicki, Boleslaw und Koop, Lars und Agocs, Janos und Frahnert, Holger und Heider, André und Mattner, Hartmut und Micknaus, Ilka und Rosenstock, Catrin und Mattner, Alexandra (2005) Application of Particle Image Velocimetry -Theory and Practice- Course Notes. Course Notes, Ordner. Volltext nicht online.

  Stanislas, Michel und Hinsch, Klaus und Westerweel, Jerry und Willert, Christian und Kähler, Christian und Ehrenfried, Klaus und Raffel, Markus und Kompenhans, Jürgen und Schröder, Andreas und Klinge, Falk und Konrath, Robert und Stasicki, Boleslaw und Koop, Lars und Agocs, Janos und Frahnert, Holger und Heider, André und Mattner, Hartmut und Micknaus, Ilka und Rosenstock, Catrin und Mattner, Alexandra (2006) Application of Particle Image Velocimetry -Theory and Practice- Course Notes. Course Notes, Ordner. Volltext nicht online.

  Starken, H. (1990) Zu- und Abströmung ebener Überschallgitter. Seminar für Strömungslehre und Strömungsmaschinen, Universität Karlsruhe, 11. Januar 1990. Volltext nicht online.

  Starken, H. (1991) Utilization of Linear Cascade Experiments in Turbomachine Design Development. Third Dynamics of Turbomachinery, Ames Iowa USA, 13.-23.08.91 Iowa State University. Volltext nicht online.

  Starken, H. (1991) Aufgaben und Ziele der Gitteraerodynamik im Institut für Antriebstechnik. Seminarvortrag, SM-AT, 29.01.91. Volltext nicht online.

  Starken, H. (1993) Sind Axialverdichter noch zu verbessern? DLR Nachrichten, 1993 (73), Seiten 21-26. Volltext nicht online.

  Starken, H. (1993) Basic Fluid Dynamic Boundary Conditions of Cascade Wind Tunnels. In: AGARDograph 328, &quot;Advanced Methods for Cascade Testing&quot;, Editor: C. Hirsch AG-328. Seiten 11-12. Volltext nicht online.

  Starken, H. (1992) Performance of Controlled Diffusion Blades. In: in VKI Lecture Series Monographs 1992-02 on &quot;Axial Flow Compressors&quot;. Volltext nicht online.

  Starken, H. und Jawtusch, V. (1993) An Improved Off-Design Loss Prediction Method for Supercritical Compressor Blades. In: Proceedings 2. ISAIF, Volume 2, Seiten 517-523. Society of Czech Mathematicians and Physicists. 2nd Internat. Symp. on Experimental and Computational Aerothermodynamics of Internal Flows, 12.-15. Juli 1993, Prag, Tschech. Rep.. Volltext nicht online.

  Starken, H. und Steinert, W. (1993) Boundary-Layer Separation and Transition Visualized by Liquid Crystal Costing. In: 11th Symp. on &quot;Measuring Techniques for Transonic and Supersonic Flow in Cascades and Turbomachines&quot;, Paper No.18, Uni BW Muenchen. Editor: L. Fottner, IB-LAT-WE12-93/05, 1993.. Volltext nicht online.

  Starken, H. und Steinert, W. (1994) Experimentelle Untersuchung des Propellerprofils P2 bei 6 Reynoldszahlen zwischen 0,2 und 1,6 x 10. DLR-Interner Bericht. 325-11-94. Volltext nicht online.

  Starken, H. und Steinert, W. (1992) Boundary Layer Separation and Transition Visualized by Liquid Drystal Coating. 11th Symposium on "Measuring Techniques for Transonic and Supersonic Flow in Cascades and Turbomachines" , , 14.-15.09.1992, Muenchen. Volltext nicht online.

  Starken, Hans (1993) Basic Fluid Dynamic Boundary Conditions of Cascade Wind Tunnels. In: AGARDograph 328, &quot;Advanced Methods for Cascade Testing&quot;, Editor: C. Hirsch AG-328. Seiten 11-12. Volltext nicht online.

  Stasicki, Boleslaw und Kompenhans, Jürgen und Willert, Christian (2010) Pulsed High-Power LED Illuminator for the Visualisation and Measurement of Flows. ISFV14 - 14th International Symposium on Flow Visualization, June 21-24, 2010, Daegu, Korea. Volltext nicht online.

  Steger, M. und Lemke, O. und Thiele, F. und Ashcroft, G. und Nürnberger, D. und Neise, W. (2006) Active control of fan interaction noise using bluff body induced secondary sources. In: ISMA-Tagung. ISMA International Conference on Noise and Engineering, 2006-09-18 - 2006-09-20, Leuven (Belgien). Volltext nicht online.

  Steinert, W. (1990) Experimental Determination of the Inlet Flow Angle of Transonic Cascades. 10th Symposium on Measuring Techniques of Transonic Flows in Cascades and Turbomachines, 17-18 September 1990, Brussels. Volltext nicht online.

  Steinert, W. (1991) Experimental determination of the inlet flow angle of transonic cascade. Proceedings of 10th Symposium VKI, Rhode-Saint-Genese, 17.-18.09.91. Volltext nicht online.

  Steinert, W. (1994) Experimentelle Untersuchung des Verdichtergitters MAN GHH RAS 92. DLR-Interner Bericht. 325-02-94, 55 S. Volltext nicht online.

  Steinert, W. (1994) Experimentelle Untersuchung des Verdichtergitters MAN GHH RAS 92. DLR-Interner Bericht. 325-02-94, 55 S. Volltext nicht online.

  Steinert, W. (1994) Experimentelle Untersuchung des Verdichtergitters MAN GHH LNS 92. DLR-Interner Bericht. 325-03-94, 84 S. Volltext nicht online.

  Steinert, W. (1995) Methode zur Darstellung von Strömungsablösung und des Grenzschichtumschlages mit Hilfe von Flüssigkristallen. DGLR-Fachausschußsitzung;Flächige Strömungsmeßverfahren; 2./3. März 1995 an der TU Berlin, 2./3. März 1995, Berlin. Volltext nicht online.

  Steinert, W. (1995) Methode zur Darstellung von Strömungsablösung und des Grenzschichtumschlages mit Hilfe von Flüssigkristallen. In: Flächige Strömungsmeßverfahren. Institut für Luft- und Raumfahrt - TU Berlin. Proceedings DGLR-Fachausschußtagung;Experimentelle Aerodynamik; 2./3. März 1995, Berlin, 2.-3. März 1995, Berlin. Volltext nicht online.

  Steinert, W. und Eisenberg, B. und Starken, H. (1991) Design and testing of a controlled diffusion airfoil cascade for industrial axial flow compressor application. ASME Journal of Turbomachinery, Band 4 (Vol. 113), Seiten 583-590. Volltext nicht online.

  Steinert, W. und Eisenberg, B. und Starken, H. (1991) Design and testing of a controlled diffusion airfoil cascade for industrial axial flow compressor application. ASME Journal of Turbomachinery, Band 4 (Vol. 113), Seiten 583-590. Volltext nicht online.

  Steinert, W. und Eisenberg, B. und Starken, H. (1991) Design and testing of a controlled diffusion airfoil cascade for industrial axial flow compressor application, ASME paper 90-GT-140. ASME International Gas Turbine and Aeroengine Congress and Exposition, 1990, Brüssel. Volltext nicht online.

  Steinert, W. und Fuchs, R. und Starken, H. (1991) Inlet flow angle determination of transonic compressor cascade. 36th ASME International Gas Turbine and Aeroengine Congress and Exposition, Orlando (USA), 03.-06.06.91. Volltext nicht online.

  Steinert, W. und Fuchs, R. und Starken, H. (1992) Inlet Flow Angle Determination of Transonic Compressor Cascades. Transactions of the ASME, Journal of Turbomachinery, Vol.144, No. 3, July 1992, 3, Seiten 487-493. The American Society of Mechnical Engineers, 345E. 47St., NY1007, USA. Volltext nicht online.

  Steinert, W. und Lohrengel, K. (1995) Experimentelle und theoretische Untersuchungen des Verdichtergitters MAN GHH LE HAMAX2 S1. DLR-Interner Bericht. 325-03-95, 131 S. Volltext nicht online.

  Steinert, W. und Schreiber, H. und Weber, A. (1996) Experimente am transsonischen Verdichtergitter DLR-TSG-89-5 bei M1= 0.9 und M1= 1.09. DLR-Interner Bericht. 325-10-96, 80 S. Volltext nicht online.

  Steinert, W. und Schreiber, H.A. (2001) Experimentelle Untersuchungen zum Einfluss der Oberflächenrauhigkeit an Verdichterprofilen des Typs CDA und HPA. Projektbericht, DLR-Interner Bericht. DLR-Datenbericht 10/01, 300 S. Volltext nicht online.

  Steinert, W. und Starken, H. (1994) Off-Design Transition and Separation Behaviour of a CDA Cascade. In: ASME-Paper 94-GT-214. The American Society of Mechanical Engineers 345E.47thSt.,NY10017USA. International Gas Turbine and Aeroengine Congress and Exposition ASME, The Hague, Netherlands, June 13-16, 1994, June 13-16, 1994, Niederlande. Volltext nicht online.

  Steinert, W. und Starken, H. (1996) Off-Design Transition and Separation Behavior of a CDA-Cascade. The American Society of Mechanical Engineers, 345 East 47th Street,. Volltext nicht online.

  Steinville, R. (2005) Calibration of a three-hole cylindrical pressure probe in sub- and supersonic flow. DLR-Interner Bericht. 225-2005 A 01, 64 S. Volltext nicht online.

  Stockhausen, G. und Fischer, M. und Heinze, J. und Müller, M. (2004) Anwendung von DGV in heissen Brennkammern. In: Lasermethoden in der Strömungsmesstechnik, 11.1-11.6. Lasermethoden in der Strömungsmesstechnik, Karlsruhe, 7-9.9.2004. ISBN 3-9805613-1-3 Volltext nicht online.

  Stollenwerk, Stefan und Nürnberger, Dirk (2009) Deterministic Stress Modelling for Transonic Compressor Flows. In: 8th European Conference on Turbomachinery, Fluid Dynamics and Thermodynamics, Seiten 267-276. Verlag der Technischen Universität Graz. ETC 2009, 2009-03-23 - 2009-03-27, Graz, Austria. ISBN 978-3-85125-036-7 Volltext nicht online.

  Strehlau, Tobias und Doll, Ullrich und Stockhausen, Guido (2010) Entwicklung eines kombinativen Messverfahrens auf Basis spektraler Filterung von Laserstreulicht zur simultanen Bestimmung von Geschwindigkeit und Temperaturen. DLR-Interner Bericht. DLR-IB-325-01-10, 97 S. file

  Strömer, J. und Schodl, R. (1991) Bestimmung des Folgeverhaltens von Partikeln in Überschalldüsen. DLR-Interner Bericht. 325-15-91. Volltext nicht online.

  Stursberg, K. (1998) Technologiestudie. DLR-Interner Bericht. 325-02-98. Volltext nicht online.

  Stursberg, K. (1991) Thrust Nozzle Test Facility at DLR Cologne. Third International Aerospace Planes Conference, 03.12.- 05.12.91, Orlando, Florida, USA. Volltext nicht online.

  Stursberg, K. (1993) Analyse des Standes der SCRAMJET-Technologie u. Entwurfsstudie zu einem SCRAMJET-Antrieb fuer einen flugzeugaehnlichen Raumtransporter (GUS-Kooperation). DLR-Interner Bericht. 325-06-93, 39 S. Volltext nicht online.

  Stursberg, K. (1993) Duesen- und Brennkammeruntersuchungen im Rahmen der MTU/DLR-Kooperation &quot;Basistechnologieentwicklung fuer Hyperschallantriebe&quot;. DLR-Interner Bericht. 325-07-93, 37 S. Volltext nicht online.

  Stursberg, K. (1997) Technologiestudie &quot;Zerstaeubung, Mischung und Flammen-Stabilitaet in hochbelasteten, schadstoffreduzierten Brennkammern fuer militaerische Triebwerke&quot;. DLR-Interner Bericht. 325-05-97, 35 S. Volltext nicht online.

  Stursberg, K. und Graben, M. und Heinze, J. und Hassa, C. (2000) Instabilities in Forced Lean Premixed Systems with Liquid Fuels and High Pressure. DLR-Interner Bericht. 325-05-00, 48 S. Volltext nicht online.

  Stursberg, K. und Hungenberg, H. G. (1991) Errichtung eines Düsenprüfstandes für Hochtemperaturuntersuchungen an Schubdüsen von Hyperschallantrieben. DLR-Interner Bericht. 325-02-91, 30 S. Volltext nicht online.

  Stursberg, K. und Hungenberg, H.G. (1993) Errichtung eines Duesenpruefstandes fuer Hochtemperaturuntersuchungen an Schubduesen von Hyperschallantrieben. DLR-Interner Bericht. 325-02-93, 105 S. Volltext nicht online.

  Stursberg, K. und Meislitzer, B. und Hungenberg, H. (1995) Düsen- und Brennkammeruntersuchungen im Rahmen der MTU/DLR-Kooperation &quot;Basistechnologieentwicklung für Hyperschallantriebe&quot;. DLR-Interner Bericht. 325-07-95, 87 S. Volltext nicht online.

  Stursberg, K. (1992) Versuchsanlage fuer die Untersuchung von RAM/SCRAM-Schubduesen bei der DLR. DLR-Interner Bericht. 325-09-92. Volltext nicht online.

  Störmer, J. und Schodl, R. (1991) Bestimmung des Folgeverhaltens von Partikeln in Überschalldüsen mit chemischer Reaktion. DLR-Interner Bericht. 325-16-91, 43 S. Volltext nicht online.

  Störmer, J., Förster, W., (1991) Erweiterung des Simulationsprogramms für das Laser-2-Fokus -Verfahren. DLR-Interner Bericht. 325-17-91, 75 S. Volltext nicht online.

  Sun, X. und Neise, W. (1995) On the Relation between Higher-order Acoustic Modes and In-duct Sound Power Measurement. In: Proc. First CEAS/AIAA Aeroacoustics Conference, Seiten 1075-1084. First CEAS/AIAA Aeroacoustics Conference (16th AIAA Aeroacoust. Conference), Munich, 12-15 June 1995. Volltext nicht online.


  Theisen, P. (1995) Erweiterung der Diskreten-Transfer-Methode zur Strahlungsberechnung auf unstrukturierten Netzen und Anwendung in einem H2-betriebenen Ramjet-Antrieb. Diplomarbeit, Universität Stuttgart?. Volltext nicht online.

  Tiedemann, M. (2000) High frequency blade surface temperature determination using surface mounted hotfilm gauges. XVth Bi-Annual Symposium on Measuring Techniques in Transonic and Supersonic Flows in Cascades and Turbomachines, Florence, 21.-22. September 2000, Florenz. Volltext nicht online.

  Tiedemann, M. und Rehder, H.-J. (2002) Überprüfung der Kalibration der neuen Keilsonde KWU3. DLR-Interner Bericht, Projektbericht. 225-2002 C 05, 66 S. Volltext nicht online.

  Tolgos, S. und Weber, A. (1996) Optimierte Tandemgitterkonfigurationen. 5. Statusseminar Arbeitsgemeinschaft Hochtemperatur-Gasturbine, 5.-6.12.96, DLR Koeln-Porz. Volltext nicht online.

  Towfighi, K. (1994) Navier Stokes Berechnungen mit dem Code &quot;Birdy&quot; - Stroemungen mit Rotation -. Vortrag in Besprechung bei der MTU Muenchen am 13.09.94. Volltext nicht online.

  Tröltzsch, Anke und Becker, Richard-Gregor und Siggel, Martin (2017) The SQP Trust-Region Algorithm ECDFO Applied to the Optimization of an Aero Engine Performance Model. In: 4th International Conference on Optimization Methods and Software 2017, Seite 73. Taylor & Francis Group. 4th International Conference on Optimization Methods and Software 2017, 16.-20. Dez. 2017, Havanna, Kuba. Volltext nicht online.


  Unger, W. (1995) Entwicklung eines Lichtwellenleiterübertragungssystems für die Erzeugung von Lichtschnitten zur Strömungssichtbarmachung. DLR-Interner Bericht. 325-01-95, 92 S. Volltext nicht online.


  Vogel, D. T. (1994) Numerische Simulation der Filmkuehlung. Seminarvortrag SM-AT, 07.09.93, Köln-Porz. Volltext nicht online.

  Vogel, D. T. (1994) Filmkuehlung an Turbinen. FVV Filmkuehlung am 10.12.93 in München, Uni der Bundeswehr. Volltext nicht online.

  Vogel, D. T. (1993) Navier-Stokes Calculation of Turbine Flows with Heat Transfer and Film Cooling. In: Proc. Int. Symp. GT and Gas Cycle Plants (1993). Int. Symposium GT and Gas Cycl Plants Bled Slowenien. Volltext nicht online.

  Vogel, D.T. (1998) Numerical Investigation of the Influence of Specific Vortex Generation on the mixing process of Film Cooling Jets. ASME-Tagung, 1998. Volltext nicht online.

  Vogel, D.T. (1994) Navier-Stokes Berechnung filmgekuehlter Turbinen. Vortrag bei der MTU-Muenchen, 01.02.1994. Volltext nicht online.

  Vogel, D.T. (1994) Numerische Berechnungen mit dem Code &quot;Birdy&quot; -Stroemung mit Ausblasung und Waermeuebertragung-. Vortrag in Besprechung bei der MTU-Muenchen, 13.09.1994. Volltext nicht online.

  Vogel, D.T. (1995) Berechnungsmethoden bei der Turbomaschinenauslegung, Zusammenarbeit DLR-MTU. In: DGLR-J 795-030. Vortrag auf der DGLR-Jahresveranstaltung in Bonn, Bad Godesberg, 28.09.1995. Volltext nicht online.

  Vogel, D.T. (1994) Navier-Stokes Calculation of Turbine Flows with Film-Cooling. 19th Congress ICAS / AIAA, Anaheim, USA, 18-23 Sept., 1994. Volltext nicht online.

  Vogel, D.T. (1994) Recent Progress of Numerical Turbine Flow Simulation at the DLR. ERCOFTAC Meeting, 25-26 April 1994, Ecole Centrale Lyon. Volltext nicht online.

  Vogel, D.T. (1994) Numerische Simulation der Kuehlluftausblasung an Turbinen. Vortrag bei der MTU Muenchen, 13.09.94. Volltext nicht online.

  Vogel, D.T. (1994) Simulation von Turbinenstroemungen auf einem Hochleistungsrechner. erscheint in BITmap. Volltext nicht online.

  Vogel, D.T. (1994) Numerical Activities at the Institute of Propulsion Technology, DLR. Vortrag NTH Trondheim, Norwegen, 28.11.1994. Volltext nicht online.

  Vogel, D.T. (1995) The Interaction between Film Cooling and Secondary Flow in a Turbine Stator Investigation of Reynolds and Turbulence Model Influence. 6th ISCFD in Lake Tahoe Nevada, USA, 4.-8.Sept. 1995. Volltext nicht online.

  Vogel, D.T. (1995) Berechnungsmethoden bei der Turbomaschinenauslegung; Zusammenarbeit DLR-MTU, Teil A. DGLR Jahrestagung, Bonn, Bad Godesberg, 28.09.1995. Volltext nicht online.

  Vogel, D.T. (1996) Navier-Stokes Simulation of the Flow around a Leading Edge Film-Cooled Turbine Blade Including the Interior Cooling System and Comparison with Experimental Data. ASME-Paper, presented at the Int. Gas Turbine and Aeroengine Congress & Exhibition, Birmingham, UK, June 10-13, 1996. Volltext nicht online.

  Vogel, D.T. (1996) Numerische Untersuchung des Mischungsverhaltens von Filmkühlstrahlen in Turbinenströmungen. Dissertation. DLR-Forschungsbericht. 96-35, 116 S. Volltext nicht online.

  Vogel, D.T. und Eulitz, F. und Carstens, C. und Fritsch, G. und Henne, J. (1998) Entwurfs- und Berechnungsverfahren für Triebwerkskomponenten aus der Kooperation MTU München und DLR. DGLR Jahrestagung, Bremen, 6.10.98. Volltext nicht online.

  Vogel, D.T. und Wilfert, G. (ABB) und Fottner, L. (UNI-BW Muenchen) (1995) Numerical and Experimental Investigation of Film-Cooling from a Row of Hole at the Suction Side of a Highly Loaded Turbine Blade. 12th ISABE Conference, 11.-15. Sept., 1995, Melbourne, Australien. Volltext nicht online.

  Vogel, T. (1991) Computation of 3D-Viscous Flow and Heat Transfer for the Application to Film-Cooled Gas Turbine Blades. AGARD, San Antonio, 27.-31.1991. Volltext nicht online.

  Vogel, T. (1994) Navier-Stokes Calculation of Turbine Flows with Film Cooling. 19th Congress ICAS/AIAA, 18-23 Sept.1994, Anaheim, USA. Volltext nicht online.

  Vogel, T. (1994) Recent Progress of Numerical Turbine Flow Simulation at the DLR. ERCOFTAC-Meeting, 25-26 April 1994, Ecole Centrale de Lyon. Volltext nicht online.

  Vogel, T. (1994) Numerische Simulation der Kuehlluftausblasung an Turbinen. Vortrag MTU, 13.09.94, Muenchen. Volltext nicht online.

  Vogel, T. (1994) Simulation von Turbinenstroemung auf einem Hochleistungsrechner. In: BITmap, Mitteilung der Zentralen Datenverarbeitung der DLR, 3/94. Vortrag, NEC/DLR-Symposium, DLR Goettingen. Volltext nicht online.

  Vogel, T. (1994) Numerical Activities at the Institute of Propulsion Technology, DLR. CFD Norway/NTH Trondheim, 28. Nov. 1994, Trondheim Norwegen. Volltext nicht online.

  Vogel, T. (1994) Nachrechnung einer filmgekuehlten, hochbelasteten Turbinenschaufel. Vortrag, Bundeswehrhochschule Muenchen, Institut fuer Strahlantriebe, 24.Juni 1994, Muenchen. Volltext nicht online.

  Vogel, T. und Kügeler, E. (1999) The Generation of Artificial Counter Rotating Vortices and the Application for Fan-Shaped Film-Cooling Holes. In: Abstracts from the 14th International Symposium on Air Breathing Engines, 73-. XIV ISABE, Florenz, Italien, 8.9.1999. ISBN 1-56347-357-7 Volltext nicht online.

  Voges, Melanie und Beversdorff, Manfred und Willert, Chris und Krain, Hartmut (2007) Application of Particle Image Velocimetry to a Transonic Centrifugal Compressor. Experiments in Fluids. Springer Verlag. DOI: 10.1007/s00348-007-0279-1 Volltext nicht online.

  Voges, Melanie und Klinner, Joachim und Willert, Chris und Beversdorff, Manfred und Schodl, Richard (2007) Assessment of Powder-based Seeding Materials for PIV Applications in Transonic, Supersonic and Reacting Flows. In: PIV'07. 7th International Symposium on Particle Image Velocimetry, 2007-09-11 - 2007-09-14, Rome, Italy. Volltext nicht online.

  Voges, Melanie und Klinner, Joachim und Willert, Chris und Blümcke, Erich (2007) PIV MESSUNGEN IN INTERAGIERENDEN ÜBERSCHALL-FREISTRAHLEN IN DRUCKBELASTETER UMGEBUNG. In: GALA 2007. 15. Fachtagung Lasermethoden in der Strömungsmesstechnik, 2007-09-04 - 2007-09-06, Rostock. Volltext nicht online.

  Voges, Melanie und Willert, Christian (2007) PIV Applied to a Transonic Centrifugal Compressor. In: Particle Image Velocimetry, a practical guide (second edition) Experimental Fluid Mechanics. Springer Verlag, Berlin, Heidelberg, New York. Seiten 332-339. ISBN 978-3-540-72307-3. Volltext nicht online.

  Voges, Melanie und Willert, Christian und Mönig, Reinhard und Schiffer, H.-P. (2013) The Effect of a Bend-Slot Casing Treatment on the Blade Tip Flow Field of a Transonic Compressor Rotor. In: ASME-Paper, GT2013-94006. ASME Turbo Expo: Power for Land, Sea and Air, 2013-06-03- 2013-06-07, San Antonio, Texas, USA. Volltext nicht online.

  Voges, Melanie und Beversdorff, Manfred und Willert, Chris und Krain, Hartmut (2006) Application of Particle Image Velocimetry to a Transonic Centrifugal Compressor. 13th International Symposium on "Applications of Laser Techniques to Fluid Mechanics", 2006-06-26 - 2006-06-29, Lisbon, Portugal. Volltext nicht frei. file

  Voges, Melanie und Klinner, Joachim und Willert, Christian (2008) Stereo PIV Messungen in einer atmosphärischen Gasturbinenbrennkammer. In: DIV4 - Diagnostik in Verbrennungen. DIV4, 2008, 2008-10-16 - 2008-10-17, Köln. (nicht veröffentlicht) Volltext nicht frei. file

  Voges, Melanie und Schnell, Rainer und Willert, Christian und Mönig, Reinhard und Müller, Martin W. und Zscherp, Carsten (2008) Investigation of Blade Tip Interaction with Casing Treatment in a Transonic Compressor - Part 1: Particle Image Velocimetry. In: ASME-Paper, GT2008-50210. ASME Turbo Expo 2008, 2008-06-09 - 2008-06-13, Berlin, Germany. Volltext nicht frei. file

  Voges, Melanie und Willert, Christian und Müller, Martin W. (2008) PIV Application to Transonic Axial and Radial Compressors. XIX Biannual Symposium on Measuring Techniques in Turbomachinery - Transonic and Supersonic Flow in Cascades and Turbomachines, 2008-04-07 - 2008-04-08, Rhodes-St-Genèse, Belgien. Volltext nicht frei. file

  Voges, Melanie und Willert, Christian und Schnell, Rainer und Müller, Martin W. und Zscherp, Carsten (2008) PIV Application for Investigation of the Rotor Blade Tip Interaction with a Casing Treatment in a Transonic Compressor Stage. 14th International Symposium on Applications of Laser Techniques to Fluid Mechanics, 2008-07-07 - 2008-07-10, Lisbon, Portugal. file

  Voigt, P. (1999) Entwicklung und Einsatz eines Laserlichtschnittverfahrens zur quantitativen Konzentrationsmessung bei Mischungsprozessen. Dissertation. DLR-Forschungsbericht. 1999-41, 104 S. Volltext nicht online.

  Voigt, P. und Schodl, R. und Griebel, P. (1997) Using the Laser Light Sheet Technique in Combustion Research. In: Proc. 90th Symp. of AGARD-PEP on &quot;Advanced Non-intrusive Instrumentation for Propulsion Engines&quot;&quot; 1997. 90th Symp. of AGARD-PEP on &quot;Advanced Non-intrusive Instrumentation for Propulsion Engines&quot;, Oct. 20-24, Bruessel, 1997. Volltext nicht online.

  Voigt, P. und Theisen, P. (1999) Experimental Analysis of Unsteady Mixing in an RQL Combustor Segment aimed for Validation of PDF Models in the Thrust Code. In: Notes on Numerical Fluid Mechanics. Vieweg Verlag. 11. AG STAB/DGLR Symposium 98, Berlin, 10.-12.11.98. Volltext nicht online.

  Voigt, Christiane und Schumann, Ulrich und Jurkat, Tina und Schäuble, Dominik und Schlager, Hans und Petzold, Andreas und Gayet, J.-F. und Krämer, M. und Schneider, J. und Borrmann, S. und Schmale, J. und Jessberger, Philipp und Hamburger, T. und Lichtenstern, Michael und Scheibe, Monika und Gourbeyre, C. und Meyer, J. und Kübbeler, M. und Frey, W. und Kalesse, H. und Butler, T. und Lawrence, M.G. und Holzäpfel, Frank und Arnold, E. und Wendisch, Manfred und Döpelheuer, A. und Gottschaldt, Klaus-Dirk und Baumann, Robert und Zöger, Martin und Sölch, Ingo und Rautenhaus, Marc und Dörnbrack, Andreas (2010) In-situ observations of young contrails âÂ�Â� overview and selected results from the CONCERT campaign. Atmospheric Chemistry and Physics, 10, Seiten 9039-9056. Copernicus Publcations. DOI: 10.5194/acp-10-9039-2010 ISSN 1680-7316 file


  Walek, M. (1999) Optimierung des Stators der 2. Stufe des Niederdruckverdichters hohen Druckverhältnisses in Leichtbauweise. Diplomarbeit. DLR-Interner Bericht. 325-03-99, 79 S. Volltext nicht online.

  Wallscheid, L. (1998) On the steady and unsteady effects of blade row spacing in a counterrotating ducted propfan. ICAS-Paper, Sept. 15, 1998, Melbourne, Australia. Volltext nicht online.

  Wallscheid, L. (1999) Phänomenologische Untersuchung der zeitabhängigen Strömung in einem gegenläufigen Propfan. Dissertation. DLR-Forschungsbericht. 1999-24. Volltext nicht online.

  Wallscheid, L. (2001) Entwicklungstendenzen bei luftatmenden Triebwerken aus Sicht der Forschung. Aktuelle Triebwerkstechnologien, Mannheim, 8.11.2001. Volltext nicht online.

  Wallscheid, L. (1993) Geometriegenerierung fuer transsonische Radialverdichter. sonstiger Bericht. Dipl.-Arbeit, Universität Bochum (RUB), Oktober 1993, 109 S. Volltext nicht online.

  Wallscheid, L. (1997) Investigation of Rotor/Rotor-Interaction. In: Proc. XIII ISABE 1997. XIII ISABE, Sept. 7-12, 1997. Volltext nicht online.

  Wallscheid, L. und Eulitz, F. und Heinecke, R. (1998) Investigation of Unsteady Flow Phenomena in a Counterrotating Ducted Propfan. ASME Tagung 1998. Volltext nicht online.

  Weber, A. (2004) G3DMESH - New of Improved Application Subroutines. DLR-Interner Bericht. 325-03-04, 103 S. Volltext nicht online.

  Weber, A. (1995) Entwicklung eines hochumlenkenden transsonischen Leitradgitters. Projektbericht, DLR-Interner Bericht. Volltext nicht online.

  Weber, A. (1995) Entwicklung eines hochumlenkenden transsonischen Leitradgitters. Projektbericht, DLR-Interner Bericht. Volltext nicht online.

  Weber, A. (1995) Entwicklung eines hochumlenkenden transsonischen Leitradgitters. In: Arbeitskreissitzung AG Turbo Turbotech, Okt. 1995. Volltext nicht online.

  Weber, A. (1996) Validierung von drei Navier-Stokes-Codes an einem transsonischen Verdichtergitter unter rein 2-dimensionalen Bedingungen. DLR-Interner Bericht. 325-09-96, 44 S. Volltext nicht online.

  Weber, A. und Fuchs, R. und Schreiber, H.A. (1999) Räumliche Strömung im transsonischen Verdichtergitter sehr hoher Belastung - Studien zur Randzonenbeeinflussung. AG-TURBO TURBOTECH, Arbeitskreissitzung, Köln, 14.-15.Okt. 1999. Volltext nicht online.

  Weber, A. und Fuchs, R. und Schreiber, H.A. und Steinert, W. (2000) Räumliche Strömungen in transsonischen Verdichtergittern sehr hoher Belastung. Abschlussbericht HTGT-TURBOTECH II, Teilvorhaben 1.132, AG-TURBO. Volltext nicht online.

  Weber, A. und Nicke, E. (1997) A Study of Blade Sweep on the Performance of a Transonic Compressor Cascade with and without Endwall Influence. In: Proc. 13th Int. Symposium on Air Breathing Engines (ISABE) 1997. 13th Int. Symposium on Air Breathing Engines (ISABE), 8.-12.9.97. Volltext nicht online.

  Weber, A. und Schreiber, H. A. und Fuchs, R. und Steinert, W. (2002) 3-D Transonic Flow in a Compressor Cascade With Shock-Induced Corner Stall. ASME Journal of Turbomachinery, Vo. 124, July 2002, Seiten 358-366. Volltext nicht online.

  Weber, A. und Schreiber, H.A. und Fuchs, R. und Steinert, W. (2001) 3D Transonic Flow in a Compressor Cascade with Shock-Induced Corner Stall. The 46th ASME International Gas Turbine and Aeroengine Technical Congress, New Orleans, USA, June 4-7, 2001. Volltext nicht online.

  Weber, A. und Schreiber, H.A. und Fuchs. R., und Steinert, W. (2001) 3D Transonic Flow in a Compressor Cascade with Shock-Induced Corner Stall. In: ASME Turbo Expo 2001, Seiten 1-12. ASME Turbo Expo 2001, New Orleans, USA, June 4-7, 2001. Volltext nicht online.

  Weber, A. und Steinert, W. (1997) Design, Optimization and Analysis of a High-Turning Transonic Tandem Compressor Cascade. In: ASME-Paper. Volltext nicht online.

  Weber, A. und Steinert, W. und Fuchs, R. und Schreiber, H.A. (1999) Testcase: 3D Flow in a Transonic Compressor Cascade (DLR TSG-97). DLR-Interner Bericht. 325-6-99, 33 S. Volltext nicht online.

  Weber, A. und Steinert, W. und Starken, H. (1991) Design and analysis of a high pitch to chord ratio cascade representative of ducted propfans. The 36th ASME International Gas Turbine and Aeroengine Congress and Exposition, Orlando (USA), 03.-06.06.91. Volltext nicht online.

  Weber, A. und Tolgos, S. (1996) Optimierte Tandemgitterkonfigurationen. 5. Statusseminar, Arbeitsgemeinschaft Hochtemperatur-Gasturbine, Sekretariat AG-Turbo, DLR, Koeln-Porz. Volltext nicht online.

  Weber, Anton (2004) 3D Structured Grids for Multistage Turbomachinery Applications based on G3DMESH (1st. Revision). DLR-Interner Bericht. 325-05-04, 77 S. Volltext nicht online.

  Weber, Anton (2004) G3DMESH - New or Improved Application Subroutines. DLR-Interner Bericht. 325-03-04, 103 S. Volltext nicht online.

  Wegener, D. (1990) Eine Methode zur Bestimmung der Lage und Intensitaet von Sekundaerwirbeln in Turbinen. DLR-Interner Bericht. 325-07-90, 100 S. Volltext nicht online.

  Wegener, D. (1991) Analyse der Strömungsverluste in einem Turbinenstator. DLR-Interner Bericht. 325-04-91, 34 S. Volltext nicht online.

  Wegener, D. (1991) Sekundärströmanalyse in Turbinenstatoren. Kolloquium Energietechnik an der RUB, 29.10.1991. Volltext nicht online.

  Wegener, D. (1991) The Secondary Vortex Theory as a Result from Advanced Measurements and Calculations. In: Third European Propulsion Forum 1991, Paris, November 1991. Volltext nicht online.

  Wegener, D. (1991) Turbine Stator Flow Analysis: Measurements, Calculations and Cooperation with ONERA. Köln, 05.12.1991. Volltext nicht online.

  Wegener, D. (1991) Rechenprogramm WIRBEL zur Analyse der Sekundärwirbel in einem Turbinenstator. DLR-Interner Bericht. 325-10-91, 69 S. Volltext nicht online.

  Wegener, D. (1991) Analyse der Strömungsverluste in einem Turbinenstator. DLR-Interner Bericht. 325-04-91, 34 S. Volltext nicht online.

  Wegener, D. (1991) Analyse der Sekundärströmungen in einem Turbinenstator. Besuch Walter Kröll im Institut AT. Volltext nicht online.

  Wegener, D. (1995) Analyse der Sekundärströmungswirbel in Turbinenstatoren unter besonderer Berücksichtigung der Eintrittsgrenzschichten. Dissertation. DLR-Forschungsbericht. 95-17, 112 S. Volltext nicht online.

  Wegener, D. und Le Meur, A. und Billonnet, B. und Escande, B. und Joudren, C. (1992) Comparison between two 3D-NS-Codes and Experiment on a turbine stator. In: 28th Joint Propulsion Conference Nashville, Tennessee, 6-8 July 1992. Volltext nicht online.

  Wehr, Lorin und Kutne, Peter und Meier, Wolfgang und Becker, Julian (2005) 1 D Single-Pulse Raman Measurements of Temperature and Mixture Fraction in a Gas Turbine Model Combustor at Elevated Pressure. In: Konferenz CD. 2. European Combustion Meeting, 2005-04-03 - 2005-04-06, Louvain-la-Neuve, Belgien. Volltext nicht online.

  Weimann, C. (1996) Numerische Untersuchung zum Rotating-Stall-effekt in einer Verdichterstufe. sonstiger Bericht. Volltext nicht online.

  Weisgerber, H. (2002) Experimentelle Untersuchungen zur Nichtgleichgewichtsexpansionsströmung nach Wasserstoff/Luft-Verbrennung in Hyperschall Staustrahltriebwerken. Dissertation. DLR-Forschungsbericht. 2002-03. Volltext nicht online.

  Weisgerber, H. und Fischer, M. und Magens, E. und Beversdorff, M. und Link, T. und Koschel, W. (1999) Experimental and Numerical Analysis of an Expansion Flow in Chemical and Thermal Nonequilibrium. In: Fourteenth International Symposium on Air Breathing Engines. AIAA. XIV ISABE, Florence, Italy; 5-10 September, 1999. ISBN 1-56347-357-7 Volltext nicht online.

  Weisgerber, H. und Fischer, M. und Magens, E. und Winandy, A. und Beversdorff, M. Foerster, W., und Cordes, S. und Meislitzer, B. (1997) Experimentelle Untersuchungen zur Expansionsstroemung nach Wasserstoff/Luft-Verbrennung in luftatmenden Hyperschallantrieben. DLR-Interner Bericht. 325-04-97, 23 S. Volltext nicht online.

  Weisgerber, H. und Fischer, M. und Magens, E. und Winandy, A. und Förster, W. und Beversdorff, M. (1998) Experimental Analysis of Exhaust Gas in a Hypersonic Nozzle. AIAA 8th International Space Planes and Hypersonic Systems and Technologies Conference, Norfolk, VA, 27-30 April, 1999. Volltext nicht online.

  Weiskat, D. (1998) Idealisierung und Integration einer manuellen Steuerung in ein FE-Modell eines Segelflugzeuges. DLR-Interner Bericht. 232 - 98 J 01. Volltext nicht online.

  Weyer, H. B. (1990) Analyse der grundlegenden Stroemungsphaenomene in Propfans. Kolloquiumsvortrag an der Universitaet Stuttgart am 18. Oktober 1990. Volltext nicht online.

  Weyer, H. B. (1990) Moeglichkeiten der Forschung an gegenlaeufigen Propfan-Triebwerken in der DLR. Seminarvortrag an der Technischen Universitaet Muenchen, 11. Januar 1 990. Volltext nicht online.

  Weyer, H. B. (1990) Technologiearbeiten und Testaktivitaeten der DLR. Planung des Demonstratorprogramms, BMFT, Bonn, 15. Februar 1990.. Volltext nicht online.

  Weyer, H. B. (1991) Aerodynamische Grundlagen der Propfans. Kolloquiumsvortrag an der Universität GH Essen, Mechanik und Strömungsmechanik, Prof. Merzkirchen, am 27.06.91. Volltext nicht online.

  Weyer, H. B. (1995) Recent Results of DLR-Aeroengine Research. NAL, Tokyo, 11.07.1995. Volltext nicht online.

  Weyer, H. B. und Neise, W. und Möser, M.. (2003) Schallentstehung bei Radialverdichtern. Abschluss-und Zwischenberichter der Foschungstellen, R520, Seiten 129-141. Volltext nicht online.