Browse by Document Type
![]() | Up a level |
A
Aberle, Bernd and Dobes, Karel and Mikusch, Eberhard and Schmid, Cornelia and Stumm, G. and Wildegger, Wilhelm and Wolfmüller, Meinhard (1992) From Telemetry Data Acquisition to Scientific Analysis The Functions of an Advanced Electrical Ground Support Equipment. Electrical Ground Support Equipment Workshop ESTEC, Noordwijk, 13.-15. Oktober 1992. Volltext nicht online. |
Ackermann, J. (1992) Robust Feedback Structures for Four-Wheel Steering of Cars. Regelungstheorie, Oberwolfach, 15.-21.03.92. Volltext nicht online. |
Ackermann, J. (1992) Robust Nonlinear Decoupling and Yaw Stabilization of Four-Wheel Steering Cars. IIASA, Wien, 01.06.92. Volltext nicht online. |
Ackermann, J. (1992) Robustness of Sampled-Data Control Systems with Physical Uncertainties in the Continuous Part. In: Proc. Symposium on Fundamentals of Discrete-Time Systems. Symposium on Fundamentals of Discrete-Time Systems, Westin Hotel Chicago, IL, 26.-27.06.92. Volltext nicht online. |
Ackermann, J. and Kaesbauer, D. and Sienel, W. and Steinhauser, R. (1992) Robust Control. CCG-Lehrgangsreihe DR 3.04, Oberpfaffenhofen, 14.-18.09.92. Volltext nicht online. |
Adam, V. (1992) Transportfuehrungssysteme fuer Transportflugzeuge. CCG-Lehrgang "Moderne Unterstuetzungssysteme fuer den Piloten", Braunschweig, 21.09.-25.09.1992. Volltext nicht online. |
Adams, N.A. (1992) Direkte numerische Simulation der Transition kompressibler Grenzschichten: Ein explizites Spektral-/Finite Differenzen-Verfahren. Seminar f&u.r Str&o.mungstechnik, TU M&u.nchen, 11.02.1992. Volltext nicht online. |
Adams, N.A. (1992) Direct Numerical Simulation of Subharmonic Transition in a Flat-Plate Boundary-Layer at Mach 4.5. Seminarvortrag, QMW London, 16.12.1992. Volltext nicht online. |
Adams, N.A. and Kleiser, L. (1992) Direkte numerische Simulation der Grenzschicht-Transition bei hohen Machzahlen. 8. DGLR Fach-Symposium Strömung mit Ablösung, 10.-12. Nov. 1992, Köln-Porz. Volltext nicht online. |
Adams, N.A. and Sandham, N.D. and Kleiser, L. (1992) A Method for Direct Numerical Simulation of Compressible Boundary-Layer Transition. In: Proc. Ninth GAMM Conference on Numerical Methods in Fluid Mechanics, Lausanne, Sept. 25-27, 1991, J.B. Vos et al. (Eds.), pp. 523-531. Vieweg, Braunschweig 1992. Ninth GAMM Conference on Numerical Methods in Fluid Mechanics, Sept. 25-27, 1991, Lausanne, Switzerland. Volltext nicht online. |
Ahmed, S. R. (1992) Sichtbarmachung der globalen Strömung um ein Hubschraubermodell im Windkanal. Strömung mit Ablösung, Köln-Porz, 10.11.1992-12.11.1992. Volltext nicht online. |
Ahmed, S. R. (1992) Analyse der PKW-Außenströmung mit Navier-Stokes-Verfahren - Stand der Entwicklung -. Aerodynamik des Kraftfahrzeuges, Essen, 24.03.1992-26.03.1992. Volltext nicht online. |
Ahmed, S.R. (1992) Analyse der PKW-Aussenstroemung mit Navier-Stokes-Verfahren - Stand der Entwicklung. Haus der Technik, Essen. Tagung "Aerodynamik des Kraftfahrzeuges", Haus der Technik e.V. Essen, 25.-26.03.92. Volltext nicht online. |
Ahmed, S.R. (1992) A Critical Review of the CFD-Methods Available to Compute Flow Around Automobiles. 3rd International Conference and Exhibition on "Innovation and reliability in automotive design and testing" bei ATA, Florenz/Italien, 8-10 April 1992. Volltext nicht online. |
Ahmed, S.R. (1992) Analyse der PKW-Aussenstroemung mit Navier-Stokes-Verfahren. - Stand der Entwicklung -. Tagung "Aerodynamik des Kraftfahrzeugs", HDT, Essen, 25.-26.3.92. Volltext nicht online. |
Albat, A. (1992) Ausschiessmethode mit veraenderlichem Bahnwinkel fuer die Flugleistungsvermessung von Segelflugzeugen. Symposium fuer Segelflugzeugentwicklung, Stuttgart, 25.-26.11.1992. Volltext nicht online. |
Albertsen, H. and Peters, P.W.M. (1992) The Influence of Fibre Surface Treatment on Interphase Properties in CFRP. In: Tagungsband, pp. 391-396. EACM, Bordeaux, Frankreich. Volltext nicht online. |
Albertsen, H. and Peters, P.W.M. (1992) The Effect of Fibre Bridging on Mode I Interlaminar Fracture Toughness in CFRP. In: Tagungsband, pp. 333-337. EACM, Bordeaux, Frankreich. Volltext nicht online. |
Albinus, U. (1992) Experimentelle Grundlagen zur Laserhochratebeschichtung. Kolloquium am Institut für Technische Physik. Volltext nicht online. |
Alheit, R. (1992) Spurenstofftransport durch Gewitter. BayFORKLIM-Koordinationskolloquium, München, 1.-3.4.1992. Volltext nicht online. |
Alheit, R. and Hauf, T. (1992) Numerical 3D-Simulations of the Vertical Transport of Passive Tracers by Midlatitude Thunderstorms. 11th International Conference on Clouds and Precipitation, Montreal, Canada, 17.-21.8.1992. Volltext nicht online. |
Allner, T. and Backhaus, R. (1992) Ein Ansatz zur Bewertung struktureller Biodiversitt mit einem Index ausFernerkundungsdaten. In: Proceedings des UTEC-Seminars 1992. Volltext nicht online. |
Altenkirch, D. (1992) Direkte Kraftsteuerung. CCG-Lehrgang LR 4.05 "Moderne Unterstuetzungssysteme fuer den Piloten", Braunschweig, 21.-25.09.1992. Volltext nicht online. |
Alvermann, K. (1992) Echtzeit-3D-Graphik und -Kurvendarstellung auf Transputern. Workshop "Verteilte Graphiksysteme", Universitaet Paderborn, 24.02.1992. Volltext nicht online. |
Alvermann, K. (1992) A Transputer Based 3D-Graphics System. In: Proceedings of the International Telemetering Conference, San Diego, CA, USA, 22 - 28 October 1992, pp. 449-454. Volltext nicht online. |
Alvermann, K. and Dzaak, F. and Gelhaar, B. (1992) A High Bandwidth Data Acquisition System. In: Proceedings of the European Telemetry Conference ETC 92, Garmisch-Partenkirchen, 12 - 14 May 1992, pp. 192-201. Volltext nicht online. |
Aoki, R. (1992) Praktische Vorfuehrung von Rechenprogrammen. Seminar Faserverbundwerkstoffe- Berechnung; DLR-Stuttgart, 3/4. Nov. 1992 Veranst.: Deutsche Ges. Materialtechnik (DGM), Oberursel/Taunus. Volltext nicht online. |
Arbter, K. (1992) Fourierdeskriptoren: Theorie und Implementierung. Seminar der Mathematischen Fakultät, Friedrich-Schiller Universität Jena, 06.07.92. Volltext nicht online. |
B
Backhaus, R. (1992) Umweltprobleme und Erdbeobachtung: Vom Satellitenbild zum strategischen Konzept. 5. Raumfahrtkolloquium an der FH Aachen 'Raumfahrt und Umwelt', 12.11.1992.. Volltext nicht online. |
Bailey, R. and et al., (1992) Numerical Calculations of High Lift Flows Using Structered and Unstructured Methods. In: AGARD-Paper 14. 71st Fluid Dynamics Panel Meeting and Symposium in High-Lift Systems Aerodynamics, Banff, 5th-8th October 1992. Volltext nicht online. |
Baily, R. and Longo, J.M.A. and Radespiel, R. and Ronzheimer, A. and Demir, A. and Kroll, N. and Rossow, C.-C. (1992) Numerical calculations of high lift flow using structured and unstructured methods. In: High-Lift Systems Aerodynamics, CP-515, 14-1-14-13. 71st Fluid Dynamics Panel Meeting and Symposium in High-Lift System Aerodynamics, Banff, Alberta (can), 05.-08.10.1992. Volltext nicht online. |
Baines, K.H.(1) and Brown, R.B.(1) and Matson, D.L.(1) and Nelson, R.M.(1) and Buratti, B.J.(1) and Bibring, J.P.(2) and Langevin, Y.(2) and Sotin, C.(2) and Carusi, A.(3) and Coradini, A.(3) and Clark, R.N.(4) and Combes, M.(5) and Drossart, P.(5) and Sicardy, B.(5) and Cruikshank, D.P.(6) and Formisano, V.(7) and Jaumann, R. (1992) VIMS/CASSINI at Titan. In: Proc. Symposium on Titan, ESA SP-338 (1992)Scientific objectives and observational scenarios., pp. 215-219. ESA. Volltext nicht online. |
Bamler, Richard (1992) Genauigkeitsanforderungen an die Bahn- und Lagebestimmung von weltraumgestützten SAR-Plattformen für die Fernerkundung. DGON-Fachausschuß-Konferenz, 1992. Volltext nicht online. |
Bamler, Richard (1992) Bildrekonstruktion aus den X-Band SAR Daten bei der SIR-C/ X-SAR Mission. In: Wissenschaftliches Kolloquium, DLR. Volltext nicht online. |
Bamler, Richard and Breit, Helko (1992) Experience with ERS-1 SAR Signal Processing at the German PAF. IEEE, New York, USA. IGARSS '92, Houston, USA, May 25 - 29, 1992. Volltext nicht online. |
Bamler, Richard and Runge, Hartmut and Steinbrecher, Ulrich (1992) A Distributed Target SAR Raw Data Simulator with Arbitrary Doppler Variation. IEEE, New York, USA. IGARSS ;92, Houston, USA, May 25 - 29, 1992. Volltext nicht online. |
Barth, M. and Joo, F. and Wei, B. and Herlach, D.M. (1992) Application of drop-calorimetry and levitation to measure thermodynamic properties of undercooled melts. 8t International Conference on Liquid and Amorphous Metals, 1992, Wien, Östereich. Volltext nicht online. |
Barth, M. and Wei, B. and Herlach, D.M. (1992) Ordnungsgrad rasch erstarrter Fe-Si Schmelzen. DPG Fruehjahrstagung Regensburg, 1992-03-16 - 1992-03-20, Regensburg (D). Volltext nicht online. |
Bartlett, A. (1992) Vertices and Segments of Interval Plants are Not Sufficient for Step Response Analysis. Regelungstheorie, Mathematisches Forschungsinstitut Oberwolfach, 15.03.-21.03.92. Volltext nicht online. |
Bauer, P. (1992) Satellitenfernerkundung in der Atmosphaeren- und Klimaforschung. 5. Raumfahrt-Kolloquium an der FH Aachen 'Raumfahrt und Umwelt'. Volltext nicht online. |
Bauer, P. and Gaito, S. and McGlade, J. and Winter, D. (1992) Estimation of Net Photosynthetically Available Radiation over Oceans From Satellite Data: Application to a Dynamical Model of a Plankton Bloom in the Atlantic Ocean. In: Proceedings of the 1. Thematic Conference on Remote Sensing of Marine and Coastal Environments, New Orleans, 15.-17.8.92. Volltext nicht online. |
Bauer, P. and Schlüssel, P. (1992) Retrieval of Cloud Liquid Water and Precipitation over Oceans From Polarized Microwave Simulations and SSM/I Measurements. In: Proceedings of the ISY '92 Conference, München, 30.3.-4.4.92. Volltext nicht online. |
Bauer, P. and Schlüssel, P. (1992) Retrieval of Cloud Liquid Water and Precipitation over Land and Oceans from Polarized Microwave Simulations and SSM/I Measurements. In: Proceedings of the International Radiation Symposium 1992, Talinn, Estland, 3.-8.8.92. Volltext nicht online. |
Bauschat, J.-M. (1992) Airborne and Ground-Based Simulation at the DLR. Scientific Aspects and their Application. In: Proceedings of the Symposium "Future Directions in Simulation" of the ARL, Melbourne, Australia, 23 - 24 June 1992. Symposium "Future Directions in Simulation" of the Aeronautical Research Laboratory (ARL), Melbourne, Australia, 23 - 24 June 1992. Volltext nicht online. |
Bechert, D.W. and Bruse, M. and Hoppe, G. (1992) Widerstandsverminderung durch Turbulenzbeeinflussung. In: DGLR-Jahrestagung Bremen, 29.9.-2.10.1992. DGLR-Jahrestagung Bremen, 29.9.-2.10.1992. DGLR-Jahrestagung, 29.9.-2.10.1992, Bremen. Volltext nicht online. |
Beck, W. and Eitelberg, G. and Vennemann, D. (1992) HEG - A new shock tunnel for high enthalpies. European Forum, Southampton University, 14.-17. Sept. 1992. Volltext nicht online. |
Beck, W. H. and Koch, U. and Müller, M. (1992) LIF Measurements on the Arc-Heated Tunnel Cologne LBK. EUROMECH 296: "Real gas effects in high enthalpy flows", DLR Goettingen, 8-10th Sept., 1992. Volltext nicht online. |
Becker, M. (1992) Das Projekt SOTA - ein Ueberblick ueber die Laufzeit 1987 - 1991. Volltext nicht online. |
Becker, M. (1992) Erfahrungen im Hochtemperaturbereich solarthermischer Kraftwerke. Volltext nicht online. |
Becker, M. and Boehmer, M. (1992) Erfahrungen mit dem GAST-Keramik-Panel. Volltext nicht online. |
Becker, M. and Boehmer, M. and Sanchez, M. (1992) Concentrating Solar Radiation - 12 Years of Overall Experience. Volltext nicht online. |
Becker, M. and Cordes, S. and Boehmer, M. (1992) The Development of Open Volumetric Receivers. 6th International Symposium on Solar Thermal Concentrating Technologies. Volltext nicht online. |
Becker, M. and Meinecke, W. (1992) Solar Thermal Power Plants. Volltext nicht online. |
Bender, W. and Ratke, L. and Feuerbacher, B. (1992) Ostwald Ripening of Solid Cobalt Particles in Liquid Copper. Volltext nicht online. |
Benz, U.C. (1992) Neuronale Netze und Fuzzy Logic in der Mikrowellen-Technologie? Wissenschaftliches Kolloquium, DLR, NE-HF, Oberpfaffenhofen, 4.12.1992.. Volltext nicht online. |
Bergemann, F. and Boyd, I. D. (1992) DSMC Simulation of Inelastic Collisions Using the Borgnakke-Larsen Method Extended to Discrete Distributions of Vibrational Energy. In: Proc. of the 18th Symposium on Rarefied Gas Dynamics, Vancouver, Canada, 1992. Vortrag 27.07.-31.07.1992. Volltext nicht online. |
Bergmann, V. and Woyde, M. and Stricker, W. (1992) H2 CARS-Thermometrie an Hochdruckflammen. DLR-Kolloquium LIF 5, Lampoldshausen, 27.+28.01.1992. Volltext nicht online. |
Bergmann, V. and Woyde, M. and Stricker, W. (1992) H2 CARS Thermometry at High Pressure. 11th CARS Workshop, Florence, Italy, 1992.. Volltext nicht online. |
Bernlochner, I. (1992) Retrospektive Katalogisierung mit OCLC-Daten - ein Praxisbericht. "Bibliotheken in alten und neuen Hochschulen"; 82. Deutscher Bibliothekartag, Bochum, 9.-13. Juni 1992.. Volltext nicht online. |
Bethke, K.-H. and Roede, B. and Schroth, A. (Vortragender) (1992) Rollverkehrsfuehrung auf Flughaefen mittels Nahbereichs-Radarnetzen. DGLR, Bonn, Germany. Vortrag gehalten auf: Deutsche Luft- und Raumfahrt-Kongress 1992, Bremen, 29.09.-02.10.92 Proc.: DGLR Jahrbuch 1992 I, GW ISSN 0070-4083. Volltext nicht online. |
Bettac, H.-D. and Mißling, K.-D. and Schwarz, J. (1992) The Remote Sensing Station Neustrelitz -Functions and Technical Objectives-. In: Europäische Telemetriekonferenz ETC'92 Garmisch-Partenkirchen 12.-14. Mai 1992. s.o.. Volltext nicht online. |
Beversdorff, M. and Heinrich, R. and Schodl, R. (1992) An L2F-Measurement Device with Image Rotator Prism for Flow Velocity Analysis in Rotating Coolant Channels. In: AGARD-PEP. 80th Symposium of the PEP on "Heat Transfer and Cooling in Gas Turbines", 12.-16.10.1992, Antalya, Turkey. Volltext nicht online. |
Bezerra, P. (CHESF) and Hille, G. and Sigler, M. and Schott, T. (ISET) (1992) Hybrid Systems for Decentral Electricity Generation. In: Lessons from a Brazilian-German Cooperation. Proc. 2nd World Renewable Energy Congress, Reading, Great Britain, 11th - 18th September 1992. Volltext nicht online. |
Bieler, H. and Redeker, G. (1992) Concepts for the Stability Analysis of NLF-Experiments on Swept Wings. AIAA, Washington D.C.. 10th AIAA Applied Aerodynamics Conference Palo Alto, California, 22nd-24th june. Volltext nicht online. |
Binder, B. and Riethmüller, L. and Tusche, S. and Wulf, R. (1992) Die Modernisierung des Transsonischen Windkanals in Göttingen. DGLR-Jahrestagung, 29.09.-02.10.1992, Bremen. Volltext nicht online. |
Binkelmann, P. (1992) Thesen zur Weiterbildung in den neuen Bundeslaendern. Fachtagung "Betriebliche Weiterbildung im Umbruch", Schwerin, 27. März 1992.. Volltext nicht online. |
Bippes, H. (1992) Experiment und lokale Stabilitaetstheorie in Grenzschichten mit laengswirbelartigen Stoerungen. 8. DGLR-Fach-Symposium mit Abloesung, Koeln-Porz, 10.-12. Nov. 1992. Volltext nicht online. |
Bippes, H. and Böttcher, J. and Wedemeyer, E. (1992) Streamwise vortex formation in oscillating stagnation flow. In: Proc. 4th Int. Conf. for Fluid Mechanics, Vol. I, pp. 279-289, Alexandria, Egypt, April 28-30, 1992. Volltext nicht online. |
Bippes, H, and Boettcher, J. and Wedemeyer, E. (1992) Streamwise Vortex Formation in Oscillating Stagnation Flow. 4th International Conference for Fluid Mechanics, Alexandria, 28th-30th April 1992. Volltext nicht online. |
Birk, Manfred (1992) FIR-FTS versus FIR-heterodyne Spectrometer: a sensitivity comparison for atmospheric application. In: SPIE Conf. Digest: 17th Int. Conf. on IR and MM Waves Pasadena, CA, USA, Dez. 1992, 1929. SPIE, Washington, USA. Volltext nicht online. |
Birk, Manfred (1992) FIR-FTS versus FIR-heterodyne spectrometer: a sensitivity comparison for atmospheric application. Proceedings of 17th International Conference on Infrared and Millimeter Waves. Volltext nicht online. |
Birk, Manfred and Hausamann, Dieter and Johns, J.W.C. (1992) Determination of Absolute Line Strengths from the Pure Rotational Spectrum of CO. 12th Colloquium on High Resolution Molecular Spectroscopy, Dijon, France, 1991.. Volltext nicht online. |
Birk, Manfred and Schreier, Franz and Hausamann, Dieter and Miller, S. (1992) Remote sensing of stratospheric OH from high altitude aircraft. In: Conf. Digest: Seventeenth Int. Conf. on IR and MM. Waves; Pasadena, CA, USA, Dez. 1992, SPIE Vol. 1929, 1929. SPIE, Washington, USA. Volltext nicht online. |
Birk, Manfred and Schreier, Franz and Hausamann, Dieter and Miller, S. (1992) Remote sensing of stratospheric OH from high altitude aircraft. Proceedings of 17th International Conference on Infrared and Millimeter Waves. Volltext nicht online. |
Bischl, A. (1992) How to Reduce Packet Errors in the 60-GHz Mobile Radio Channel - An Overview -. PRO-COM Workshop in Paris, Frankreich, 1.10.1992. Volltext nicht online. |
Bischl, H. (1992) Kanalmodelle fuer den Vielfachzugriff. Vortrag am Lehrstuhl fuer Nachrichtentechnik (Prof. Troendle) an der BWH in Neubiberg am 14.4.1992. Volltext nicht online. |
Bischl, H. (1992) Kanalmodelle fuer den Vielfachzugriff und spezielle Zugriffsverfahren. DLR-Institutskolloquium am 25.11.92 in OP. Volltext nicht online. |
Bischl, H. (1992) Packet Errors in the 60-GHz Mobile Radio Channel. PRO-COM Workshop in Bologna, Italien, 21.2.1992. Volltext nicht online. |
Blazek, J. (1992) Damping and Convergence Properties of the Implicit LU-SSOR Scheme. Vortrag beim HERMES R/Q-Meeting, Bruessel, 20.10.1992-22.10.1992. Volltext nicht online. |
Blazek, J. and Kroll, N. and Rossow, C.-C. (1992) A Comparison of Several Implicit Smoothing Methods. ICFD Conference on Numerical Methods for Fluid Dynamics, Reading, UK, 7-10.4.1992. Volltext nicht online. |
Block, I. (1992) Graviresponse of Physarum - Investigations in Actual and Simulated Weightlessness. European Physarum Congress, Innsbruck, sterreich, 07.-12.04.92. Volltext nicht online. |
Block, I. and Briegleb, W. (1992) Gravitational Response of Physarum plasmodia. In: Europ. J. of Cell Biol., 57. Meeting der Deutschen Gesellschaft für Zellbiologie (DGZ), Konstanz, 15.-20.03.1992. Volltext nicht online. |
Block, Joachim (1992) Schallemissions-Messungen an CFK. Seminar: Schallemissions-Analyse an modernen Werkstoffen, 16. - 18. 9. 1992, Ortenburg. Volltext nicht online. |
Block, Joachim (1992) Zur Problematik der hohen Signaldichte bei der Pruefung verstaerkter Polymere. Seminar: "Schallemissions-Analyse an modernen Werkstoffen", Ortenburg, 16., 17. und 18.9. 1992. Volltext nicht online. |
Bluemcke, E. and Brandt, M. and Eickhoff, H. and Hassa, Ch. (1992) Experimental and Theoretical Investigation of a Research Atomizer Combustion Chamber Configuration. In: ASME International Gas Turbine Conference 1992, paper 137. ASME, New York, USA. Volltext nicht online. |
Blume H. T., etal. (1992) Definition of a European Promotion Concept. In: Proceedings of Satellite Symposium 4, pp. 251-255. ESA Publications Division, ESTEC, Noordwijk, The Netherlands. International Space Year Conference, Munich, 30 March-4 April 1992. Volltext nicht online. |
Blume H. T., etal. (1992) Training Concept for Crew, and User, and Ground Centre Personnel in the Columbus Utilization Programme. In: Proceedings of Satellite Symposium 4, pp. 257-262. ESA Publications Division, ESTEC, Noordwijk, The Netherlands. Internatinal Space Year Conference, Munich, 30 March-4 April 1992. Volltext nicht online. |
Blume H. T., etal. (1992) A Refined Decentralized Concept of User SUPPort for The Columbus Elements Attached Laboratory and Free Flyer. International Astronautical Federation. 43. Kongress der Internationalen Astronautischen Foederation (IAF) 28. August-5. Sept. 1992 in Washington DC, USA. Volltext nicht online. |
Blume H.T., etal. (1992) The Refined Decentralized Concept and Development Support. In: Proceedings of Satellite Symposium 4, pp. 235-239. ESA Publication Division, ESTEC, Noordwijk, The Netherlands. International Space Year Confernce, Munich, 30 Mach-4 April 1992. Volltext nicht online. |
Blumer, P. (1992) A Future Concept of Coordinated Orbit Control of Colocated Geostationary Satellites. Paper zum Vortrag auf der AIAA/AAS Astrodynamics Conference, Hilton Head, SC, USA, August 10-12, 1992. Volltext nicht online. |
Boehmer, M. (1992) Neuartige Konzepte der solaren Stromerzeugung in kleinen Einheiten. SOTA-Abschlusspraesentation 10. u. 11.06.92 D L R - Koeln. Volltext nicht online. |
Boehmer, M. (1992) Neuartige Konzepte der solaren Stromerzeugung in kleinen Einheiten. SOTA-Abschlusspraesentation 10./11.06.92 D L R - Koeln. Volltext nicht online. |
Boehmer, M. and Cordes, S. (1992) Der offene volumetrische Receiver. Einfuehrung und Ueberblick ueber die Tests auf der PSA. SOTA-Abschlusspraesentation, 10. u. 11.06.1992 D L R - Koeln. Volltext nicht online. |
Boehmer, M. and Langnickel, U. and Rodriguez Povedano, J.A and Sanchez, M. and Valverde, A. (CIEMAT-IER, Plataforma de Almeria, (1992) Solar Steam Reforming of Methane. 6th International Symposium on Solar Thermal Concentrating Technologies. 28.09. - 02.10.92, Mojacar, Spanien. Volltext nicht online. |
Boettcher, A. (1992) Static and Dynamic Stabilization of Slotted Aloha in Transmission Channels with Capture. In: IEEE ICWC'92, pp. 35-38. Intern. Conf. on Sel. Topics in Wireless Comm. (ICWC'92), 25. - 26. Juni 1992, Vancouver, Canada. Volltext nicht online. |
Boettcher, A. (1992) Vergleich von Vielfachzugriffsverfahren fuer paketorientierte Datenuebertragung. Raumfahrt-Kolloquium am 16.9.92 bei ANT in Backnang. Volltext nicht online. |
Boettcher, J. and Dobrzynski, W. and Gehlhar, B. (1992) Broadband Noise Characteristics of a Model Counter Rotating Shrouded Propfan. In: Proceedings of the 1992 International Congress on Noise Control Engineering, pp. 931-934. Inter-Noise 92, Toronto, 20.-22.07.1992. Volltext nicht online. |
Boettcher, J. and Dobrzynski, W. and Gehlhar, B. (1992) Bedeutung und Charakteristika des Breitbandlaerms bei einem gegenrotierenden Propfan. Sitzung des DGLR Fachausschusses T2.4 Stroemungsakustik/Fluglaerm, Braunschweig, 12.11.1992. Volltext nicht online. |
Boettcher, J. and Michel, U. (1992) The Noise of Jet Aircraft Flying with High Speeds at Low Altitudes. DGLR/AIAA 14th Aeroacoustics Conference, 11.-14. Mai 1992, Aachen. Volltext nicht online. |
Boettcher, J. and Michel, U. (1992) Prediction of Jet Mixing Noise in High-Speed Flight. DGLR/AIAA 14th Aeroacoustics Conference, May 11-14, 1992, Aachen. Volltext nicht online. |
Bohn, W.L. (1992) The Chemical Oxygen Iodine Laser: Achievements, Problems and Future Perspectives. 9th International Symposium on Gas Flow and Chemical Lasers, 21-25 September 1992, Heraklion, Crete, Greece. Volltext nicht online. |
Bohn, W.L. (1992) Principes fondamentaux et technologie du laser chimique oxygene-iode. Science, Technologie et Lasers de Puissance, Colloque Interdisciplina ire du CNRS, 30 Nov, 1 et 2 Decembre 1992, Gif-sur-Yvette, France. Volltext nicht online. |
Bohn, W.L. (1992) Chemische Laser. Hochenergielaser - Technik, Transmission und Wirkung, Carl-Cranz-Gese llschaft, Seminar SE 1.10, 3.-5.1.92, Oberpfaffenhofen. Volltext nicht online. |
Bohn, W.L. (1992) Hochenergielaser in der Wehrtechnik. Generalstabsausbildung an der Führungsakademie der Bundeswehr in Hamburg-Blankenese, 30.3.-3.4.1992.. Volltext nicht online. |
Bohn, W.L. (1992) Status Review of German High Energy Laser Program. Informationsveranstaltung anläßlich eines Besuchs bei der Eglin Air Force Base, 13.4.92, Florida/USA.. Volltext nicht online. |
Bollner, M. and Feucht, U. and Rupp, T. (1992) Usage of a Sun Sensor / Magnetometer combination to replace gyros within a high accuracy attitude control system. 43rd Congress of the International Astronautical Federation, Washington DC, USA, Aug 28 - Sept 5, 1992. Volltext nicht online. |
Bolwin, K. and Hauff, S. and Reitz, J. (1992) Hydrogen-Based Regenerative Fuel Cell System for Space Power Supply. In: Proc. 9th WHEC 1992, Vol. 3, pp. 1593-1602. 9th WHEC, Paris, 22nd - 25th June 1992. Volltext nicht online. |
Borck, V. and Henne, R. and Schiller, G. and Schnurnberger, W. (1992) Elektroden fuer die alkalische Wasserelektrolyse. In: Proc. VDI-GET-Tagung, pp. 13-23. Proc. VDI-GET-Tagung Wasserstoffenergietechnik III, Nürnberg, 18./19. 02.1992. Volltext nicht online. |
Bothe, H. (1992) Telemetry for Flight Test Applications. AGARD-Cranfield Special Short Course on Flight Test Instrumentation Cranfield, Bedfordshire MK43 OAL, UK, 24.-28.2.92. Volltext nicht online. |
Bothe, H. (1992) Distance Measurements - a By-Product of Telemetry Data Links. Europaeische Telemetriekonferenz (ETC 1992), Garmisch-Partenkirchen, 12.-14.5.92. Volltext nicht online. |
Bouwer, G. (1992) Technik der Simulation im Fluge bei Hubschraubern (ATTHeS). CCG-Lehrgang LR 11.01 "Flug- und Systemsimulation", Braunschweig, 23.-27.03.1992. Volltext nicht online. |
Bouwer, G. (1992) Ein Modellfolge-Regler hoher Bandbreite fuer den Hubschrauber-In-Flight-Simulator ATTHeS. Kolloquium Projektbereich A, Sonderforschungsbereich 212, TU Braunschweig, 25.08.1992. Volltext nicht online. |
Bouwer, G. and Pausder, H.-J. and Grünhagen, W. von (1992) ATTHeS - A Helicopter In-Flight Simulator with High Bandwidth Capability. In: AHS Proceedings 1992, Vol. 2, pp. 1211-1224. 48th AHS Annual Forum and Technology Display, Washington, DC, USA, 3 - 5 June 1992. Volltext nicht online. |
Brandt, M. and Eickhoff, H. and Hassa, Ch. (1992) An Experimental Study of Spray-Gasphase Interaction for a Co-Swirling Airblast Atomizer. In: 8th Annual Conference of the European ILASS, pp. 115-122. Shell, Amsterdam, Netherlands. Volltext nicht online. |
Brandt, M. and Hassa, Ch. and Kneer, R. and Lisiecki, D. and Tam, I. and Ledoux, M. and Cormack, G. and Hawkins, H.L. and Zasuja, A.K. (1992) Cross Correlation of Three Drop Sizing Techniques. In: 6th Int. Symp. on Appl. of Laser Techniques to Fluid Mechanics. Ladoan, Lisboa, Portugal. Volltext nicht online. |
Brauch, U. (1992) Festkoerperlaser. Seminar SE 1.10 "Hochenergielaser - Transmission und Wirkung", Oberpfaffenhofen, 3.-5.11.1992. Volltext nicht online. |
Braue, W. (1992) Korn- und Phasengrenzen in Gefuegen. Vorlesung, Universität Würzburg, Sommersemester 1992. Volltext nicht online. |
Braue, W. (1992) Elektronenmikroskopie innerer Grenzflaechen in strukturkeramischen Werkstoffen. 70. Jahrestagung der Deutschen Mineralogischen Gesellschaft, Tübingen, 12.-20.09.1992. Volltext nicht online. |
Braue, W. (1992) Elektronenmikroskopie versagensrelevanter Gefügeelemente in strukturkeramischen Werkstoffen. Jahrestagung der Deutschen Gesellschaft für Materialkunde (DGM), Hamburg, 09.- 12.06.1992. Volltext nicht online. |
Braun, G. and Winiger, M. (1992) Vegetation Mapping and a Statistical Approach for the Reconstruction of the Potential Forest Cover Using LANDSAT-5-TM-Data and DTM. In: Environment Observation and Climate Modelling Through International Projects., pp. 381-385. ISI, Munich, 1992. Volltext nicht online. |
Braun, R. (1992) On the Exfoliation Corrosion and Stress Corrosion Cracking Behaviour of 2091-T8x51 Plate Material. In: Aluminium-Lithium, M. Peters and P.-J. Winkler (Eds.), pp. 697-702. DGM Informationsgesellschaft mbH, Oberursel. Volltext nicht online. |
Braun, R. and Buhl, H. (1992) Corrosion Properties of 2091 CPHK Sheet Material. In: Aluminium Lithium, M.Peters and P.-J. Winkler, Eds., pp. 807-812. DGM Informationsgesellschaft mbH, Oberursel. Volltext nicht online. |
Breitbach, E. (1992) Intelligente Struktursysteme - Potential und Chancen einer neuen Technologie. Universitaet Hannover am 25.05.1992.. Volltext nicht online. |
Breitbach, E. (1992) Intelligente Struktursysteme - Wissenschaftliches Umfeld. Kommissionssitzung "Intelligente Struktursysteme", Niedersaechsisches Ministeirum fuer Wirtschaft, Technologie und Verkehr, Friedrichswall 1, 3000 Hannover 1, am 19.05.1992.. Volltext nicht online. |
Breitbach, E. (1992) Intelligente Struktursysteme - Potential und Chancen einer neuen Technologie. In der Bundeswehrhochschule Muenchen am 20.02.1992.. Volltext nicht online. |
Breitbach, E. J. and Campanile, L. F. (1992) Schadensdetektion mit Hilfe der strukturdynamischen Systemidentifikation. bei MBB Muenchen am 19.02.1992.. Volltext nicht online. |
Breitbach, E. J. and Wimmel, R. (1992) The Challenge of Adaptive Structures. World Space Congress, Washington, D.C., USA, August 28 - September 5, 1992, IAF Symposium on Materials and Structures.. Volltext nicht online. |
Brinkop, S. and Roeckner, E. (1992) Parametrization of the Interaction between Boundary Layer Clouds and their Environment (Poster). Second Intern. Conf. on Modelling of Global Climate Change and Variability, 7.-11.9.92, Hamburg. Volltext nicht online. |
Brinson, L.C. (1992) Constitutive Behavior of Shape Memory Alloys: One dimensional thermomechanical derivation with non-constant material functions and redefined martensite internal variable. Technomic Publishers, Inc.; USA. "Recent Advances in Adaptive and Sensory Materials and their Applications", April 27-29, 1992, Virginia Tech, Blacksburg, VA, USA.. Volltext nicht online. |
Brogniez, G. and Busen, R. and Fimpel, H. and Lorenz, D. and Wendling, P. and Francis, P. (1992) Comparison of Measured Broad Band Longwave Fluxes from Aircraft Data during the PRE-EUCREX Campaign. In: Report of: Fifth ICE/EUCREX Workshop, Clermont-Ferrand, France, June 1-4, 1992, pp. 81-85. Volltext nicht online. |
Brown, R.H.(1) and Baines, H.H.(1) and Buratti, B.J.(1) and Matson, D.L.(1) and Nelson, R.M.(1) and Clark, R.N.(2) and Cruikshank, D.P.(3) and Nicholson, P.(4) and Bibring, J.P.(5) and Langevin, Y.(5) and Sotin, C.(5) and Combes, M. (6) and Drossart, P.(6) and Sicardy, B.(6) and Jaumann, R. and Carusi, A.(7) and Coradini, A.(7) and Formisano, V.(8) (1992) The Cassini Visual Infrared Mapping Spectrometer. In: Capistrano Conf. No. 2 on Infrared Spectroscopy of Surfaces, Abstract Volume, pp. 19-20. Volltext nicht online. |
Brown, R.H.(1) and Jaumann, R. and Nelson, R.H.(1) and Matson, D.L.(1) and Baines, K.H.(1) and Buratti, B.(1) and Cruikshank, D.P.(2) and Clark, R.N.(3) and Carusi, A.(4) and Coradini, A.(4) and Bibring, J.P.(5) and Sotin, C.(5) and Langevin, Y.(5) and Formisano, V.(6) and Combes, H.(7) and Drossart, P.(7) and Sicardi, B.(7) (1992) Cassini - VIMS: Ein abbildendes Spektrometer zur Erforschung des Saturn. In: Verhandlungen DPG 27 (1992) VI, 27. Volltext nicht online. |
Bublitz, P. (1992) Der Einfluss der Triebwerke bei den stationaeren Modellversuchen mit dem Modell 412D und dem JAMP Modell A. Vortrag bei Deutsche Airbus in Bremen am 23. Juni 1992.. Volltext nicht online. |
Bucher, W. (1992) Solar Power Generation in Competition with Conventional Power Sources. Solar Energy Conference, Cairo, December 1992. Volltext nicht online. |
Bucher, W. (1992) PV-Bewaesserungssysteme als technische Herausforderung. In: Proceedings (1992). DSG Sonnenenergie Verlagsgesellschaft mbH, München. Sonnenforum Berlin, 30. Juni - 3. Juli 1992, Berlin.. Volltext nicht online. |
Bucher, W. (1992) Solar Power Generation in Competition with Conventional Power Sources. In: Proc. of the Cairo 3rd Int. Conf. on Renewable Energy Sources (1992). Solar Energy Conference, Cairo, 29 December 1992-3 January 1993.. Volltext nicht online. |
Bucher, W. (1992) Renewable Energy Equipment and the Role of an INT L Solar Energy Agency. In: Proc. (1992). Seminar in Cairo anläßl. des NRC-Meetings v. 14. - 16. Dez. 92. Volltext nicht online. |
Bucher, W. and Bechteler, W. (1) and Zängerl, H. P. (1) and Mayer, O. (1) (1992) Abrasion Tests on Pumps for PV Applications. In: Proceedings (1992). Kluwer Academic Publishers, Dordrecht, Boston, London. 11th European PV Solar Energy Conference, 12-16 October 1992, Montreux.. Volltext nicht online. |
Buckreuß, S. (1992) Bewegungskompensation für flugzeuggetragene SAR-Systeme. Wissenschaftliches Kolloquium, Oberpfaffenhofen, 5.11.1992. Volltext nicht online. |
Buckreuß, S. and Horn, R. and Meier, E. and Moreira, J. and Piesbergen, J. (1992) Hochgenaue Prozessierung und Geokodierung von Flugzeug-SAR-Daten. Wissenschaftliches Kolloquium, Oberpfaffenhofen, 25.11.92. Volltext nicht online. |
Bunk, W. (1992) Advanced Aerospace Materials for Hypersonic Applications. Volltext nicht online. |
Bunk, W. and Krüger, W. and MTU, Motoren- und Turbinen Union München (1992) Ceramic Materials and Component Design for Aerospace Applications. 4th International Symposium "Ceramic Materials & Components for Engines" June 10-12, 1991, Goeteborg, Schweden. Volltext nicht online. |
Bunk, W. and Winkler, P.-J.* *Messerschmitt-Bölkow-Blohm GmbH, Ottobrunn, (1992) Das Potential von Aluminiumlegierungen fuer zukuenftige Luft- und Raumfahrtprojekte. Vorgetragen auf dem BDLI-Werkstofftag '91 13.-15. Nov. 1991, Hamburg. Volltext nicht online. |
Busca, G. *) (Vortragender) and Starker, S. and Feltham, S. **) (1992) In Orbit Demonstration of a H-Maser Clock System. Vortrag, gehalten auf: 23rd Annual Precise Time and Time Interval (PTTI) Applications and Planning Meeting, 3-5 Dec. 1991, Pasadena, Calif. USA. Proc.: 23rd Annual Precise Time and Time Interval (PTTI) Applications and Planning Meeting, NASA-CP 3159.. Volltext nicht online. |
Busen, R. (1992) STRATO 2C: A New Aircraft for Stratospheric Research. In: Report of: Fifth ICE/EUCREX Workshop, Clermand Ferrand, France, June 1-4, 1992, pp. 105-107. Volltext nicht online. |
Busen, R. and Brown, P.R.A.(1) and Guillemet, B.(2) and Ström, J.(3) (1992) The PRE-EUCREX Intercomparison Flights: First Results of the Humidity Instrumentation Intercomparison. In: Report of: Fifth ICE/EUCREX Workshop, Clermont Ferrand, France, June 1-4, 1992, pp. 77-79. Volltext nicht online. |
Böhnisch, H. (1) and Kirner, W. (2) and Nitsch, J. and Steinborn, F. (1) (1992) Integration erneuerbarer Energiequellen in die Stromversorgung einer Kommune, dargestellt am Beispiel der Stadt Rottweil. In: Tagungsbericht. 8. Int. Sonnenforum, Berlin, 30.06.-03.07.1992. Volltext nicht online. |
Bülow, H. von and Zeyfang, E. and Schellhorn, M. (1) (1992) Gasdynamically Cooled CO-Laser in the Multi-kW-Range. 9th Int.Symposium on Gas Flow and Chemical Lasers (GCL), Heraklion, September 1992.. Volltext nicht online. |
Böttcher, J. and Michel, U. (1992) The Noise of Jet Aircraft Flying with High Speeds at Low Altitudes. In: DGLR-Bericht 1992-03 (1992), pp. 863-872. DGLR/AIAA 14th Aeroacoustics Conference 11-14th May 1992, Aachen. Volltext nicht online. |
Bütefisch, K.A. and Seelhorst, U. (Vortragender) (1992) "LDA-Aktivitten im Rahmen des co-rot Teilprogrammes". Praesentation CP-ROT / Instationaere Rotoraeromechanik, DLR Braunschweig. Volltext nicht online. |
C
Carstens, V. (1992) Computation of the Unsteady Transonic 2D Cascade Flow by an Euler Algorithm with Interactive Grid Generation. In: AGARD Conference Proceedings 507, Transonic Unsteady Aerodynamics and Aeroelsticity, March 1992.. Printed by Specialised Printing Services Ltd.,40 Chigwell Lane, Loughton, Essex IG10 3TZ, GB.. Papers presented at the 73rd Meeting of the AGARD Structures and Materials Panel, San Diego, Ca., USA, 7th-11th October 1991.. Volltext nicht online. |
Center, K.B., Jones, K.D., Dougherty, F.C., Seebass, A.R., Sobieczky, H., (1992) Interactive Hypersonic Waverider Design and Optimization. In: Proc. of the 18th Congress of the Intenational Council for Aerospace Sciences (ICAS), Beijing, People's Republic ofChina,. 20.-25.09.1992. Volltext nicht online. |
Chandra, M. (1992) Remote Sensing of Weather by Coherent Polarimetric Radars for Satellite-Propagation and Hydrological Research: An Impression of the State of the Art. Vortrag, gehalten auf: INTA Congress Celebrating its 50th Anniversary, Madrid, Spain, 26.10.92. Volltext nicht online. |
Chandra, M. (1992) Some Polarimetric Weather Radar Signatures and their Interpretation. DLR, OP, Germany. Vortrag, gehalten auf: Microwave Signature '92, URSI, Igls-Innsbruck, Austria, 1.-3.7.92. Proc.: Microwave Signature '92. Volltext nicht online. |
Chandra, M. (1992) Transmission of Electromagnetic Energy Through the Atmosphere. Vortrag, gehalten auf: NATO Schule, Oberammergau, 13.7.92. Volltext nicht online. |
Chandra, M. (1992) Rain Intensity Estimation by Ground Based Coherent Polarimetric Radars. SPIE, Bellingham, Washington, USA. Vortrag: SPIE "92 Internat. Symp., San Diego, USA, 19.-24.7.92. Proc.: SPIE - The Internat. Society for Optical Engineering "Radar Polarimetry", ISBN 0-8194-0921-9. Volltext nicht online. |
Cordes, S. (1992) Status of the SBP Heliostat Test. In: SolarPACES Technical Report No. 1/92, Proceedings of the first meeting of SolarPACES - task 3 -, pp. 65-76. D L R, MD-ET. Volltext nicht online. |
Cordes, S. and Becker, M. (1992) Vergleich der verschiedenen volumetrischen Receiver und Chancen der Optimierung. Abschlusspraesentation zum Projekt SOTA. Volltext nicht online. |
Cordes, S. and Boehmer, M. (1992) Der volumetrische keramische Folienreceiver. Abschlusspraesentation zum Projekt SOTA. Volltext nicht online. |
Cordes, S. and Boehmer, M. (1992) Die Entwicklung offener volumetrischer Solar-Receiver. In: Vortrag und Beitrag im Tagungsbericht, 8. Internationales Sonnenforum, 1992 Berlin, pp. 406-418. DGS-Sonnenenergie Verlags-GmbH Muenchen, Deutschland. Volltext nicht online. |
Cordes, S. and Boehmer, M. and Monterreal, R. (1992) Test and Evaluation of a Prototype 44 m/2 Streched Membrane Heliostat. 6th International Symposium on Solar Thermal Concentrating Technologies. Volltext nicht online. |
Cordes, S. and Fiebig, M. and Pitz-Paal, R. (1992) First Experimental Results from the Test of a Selective Volumetric Air Receiver. 6th International Symposium on Solar Thermal Concentrating Technologies. Volltext nicht online. |
Cordes, S. and Pitz-Paal, R. (1992) First Experimental Results of a Selective Volumetric Receiver Test. In: SolarPACES Technical Report No. 1/92, Proceedings of the first meeting of SolarPACES - task 3 -, pp. 205-213. D L R, MD-ET. Volltext nicht online. |
Correll, Ch. and Franz, J. (1992) Benefit of Error Correcting Coding in Coherent Optical Communication Systems. In: Proc. of the 1992 Bilkent Intern. Conf. on Lightwave Technology and Communications, pp. 56-62. BILCON'92 vom 27. - 28. 7.1992 , Bilkent Univ., Ankara, Tuerkei. Volltext nicht online. |
Costes, M, and Houwink, R, and Kokkalis, A, and Pahlke, K, and Saporiti, A. (1992) Application of European CFD Methods for Helicopter Rotors in Forward Flight. In: 18th European Rotorcraft Forum. 18th European Rotorcraft Forum, Avignon, 15.-18.09.1992. Volltext nicht online. |
D
Daiqui, S. and Beck, L. and Baisch, F. (1992) Interstitial space dynamics: Simulated response to LBNP. In: The Physiologist, 35(1), 35(1)-. American Physiological Society and The Galileo Foundation. Proceedings of the 13th Annual Meeting of the IUPS Commission on Gravitational Physiology. Volltext nicht online. |
Dalle Donne, C. and Bachmann, V. and Döker, H. (1992) Kontinuierliche Ermittlung der stabilen Rißverlängerung an zähen Werkstoffen mit der Potentialmethode. DVM Arbeitskreis Bruchvorgänge, 18.02.-19.02.1992, Aachen. Volltext nicht online. |
Dallmann, U. (1992) Sekundaere und nichtlineare Instabilitaetsanalyse zur laminar-turbulenten Transitionsvorhersage. Vortrag am 25. Januar 1992 in Goettingen, Mechanik-Kolloquium der Niedersaechsischen, Hamburger und Berliner Hochschulen. Volltext nicht online. |
Dallmann, U. (Vortragender), Fischer, T.M., Koch, W., Bippes, H., (1992) On the Role of Secondary Instabilities to Laminar-Turbulent Transition of 2D and 3D Boundary Layers. Fifth Symp. on Num. and Phys. Aspects of Aerodynamic Flows, Calif. State University, Long Beach, Ca., USA, 13.01.1992. Volltext nicht online. |
Dallmann, U. (Vortragender), Gebing, H., Vollmers, H., (1992) Unsteady Three-Dimensional Separated Flows Around Spheres and Ellipsoids - Analysis of Vortex Chain Formation. IUTAM Symposium on Bluff-Body Wakes, Dynamics and Instabilities, Goettingen, 7.-11.09.1992. Volltext nicht online. |
Dallmann, U., Gebing, H., Vollmers, H. (Vortragender), (1992) Unsteady Three-Dimensional Separated Flows Around Spheres and Ellipsoids - Analysis of Vortex Chain Formation. IUTAM Symposium on Bluff-Body Wakes, Dynamics and Instabilities, Goettingen, 8. Sept. 1992, MPI Goettingen. Volltext nicht online. |
Dameris, M. (1992) Ueber die Modellierung von Stratosphaerenerwaermungen. Deutsche Meteorologentagung 1992,Berlin, 16.-20.3.92. Volltext nicht online. |
Dameris, M. (Vortragender) and Pawson, S. (1992) Three-Dimensional Modelling of Solar Activity Effects on the Middle Atmosphere. Vortrag, gehalten auf: World Space Congress, Washington, USA, 3.9.92. Volltext nicht online. |
Dankert, C. and Gundlach, G. and Legge, H. and Beck, W. (1992) Temperature Measurement in Hypersonic Flow by LIF. 18th Rarefied Gas Dynamics Symposium (RGD), Vancouver/Canada 26.7.-31.7.92. Volltext nicht online. |
Dankert, C. and Hirai, E. and Gundlach, G. and Legge, H. (1992) Temperature Measurement in Hypersonic Flow with Gas-Surface-Interaction. IUTAM Symposium on "Aerothermochemistry of Spacecrafts and Associated Hypersonic Flows", Marseille/France, 1.-4. Sept. 1992. Volltext nicht online. |
Das Chowdhury, K. and Carpenter, R.W. and Braue, W. (1992) A PEELS Study of Si/SiC Interface in Reaction-Bonded SiC. 94th Annual Meeting of the American Ceramic Society, Minneapolis, USA, 12.-16.04.1992. Volltext nicht online. |
Das Chowdhury, K. and Carpenter, R.W. and Braue, W. (1992) Analytical Electron Microscopy of Reaction-Bonded SiC. In: 50th Annual Meeting of the Electron Microscopy Society of America, August 16-21, 1992, Boston/Ma., USA. Volltext nicht online. |
Daum, A. (1992) Solving the aeroassisted orbital transfer problem by using a sequential optimization approach. In: AIAA Atmospheric Flight Mechanic Conference, AIAA Paper 92-4646. Volltext nicht online. |
Daum, A. (1992) TRANSYS - A Software System for Preliminary Design, Analysis and Evaluation of Space Transportation Systems. Seminar at the Department of Aerospace Engineering, Pennsylvania State University, University Park, PA, August 1992. Volltext nicht online. |
Davies, K. and Degenhardt, W. and Hartmann, G.(MPI, Lindau) Jakowski, N., and Leitinger, R.(Uni Graz) (1992) Relationships between ionospheric electron content and solar fluxes. In: Proc. of International Beacon Satellite Symposium July 6.-10., 1992, Cambridge, MA/USA, pp. 188-191. erstellt an MIT, Cambridge, MA/USA. Volltext nicht online. |
Degener, M. (1992) Gesichtspunkte und Anwendungsbeispiele zur Durchfuehrung von Schwingungsuntersuchungen. Seminar DR 1.01 der Carl-Cranz-Gesellschaft: "Experimentelle Modalanalyse - Ein modernes Hilfsmittel zur Loesung strukturdynamischer Probleme", Goettingen, 18.-21.05.1992.. Volltext nicht online. |
Degener, M. (1992) Bestimmung der dynamischen Antwort elastischer Strukturen. Seminar DR 1.01 der Carl-Cranz-Gesellschaft: "Experimentelle Modalanalyse - Ein modernes Hilfsmittel zur Loesung strukturdynamischer Probleme", Goettingen, 18.-21.05.1992.. Volltext nicht online. |
Di Martino, M.(1) and Gonano-Beurer, M. and Mottola, S. and Neukum, G. (1992) A Photometric Survey of Outer Belt Asteroids. In: Asteroids, Comets, Meteors 1991, pp. 157-160. Lunar and Planetary Institute, Houston, USA. Volltext nicht online. |
Diefenbach, A. and Gillessen, F. and Herlach, D.M. and Dietz, G. (1) (1992) Glass formation in containerlessly processed droplets of Fe-Ni-P-B alloy melts. 8th International Conference on Liquid and Amorphous Metals Wien, 1992. Volltext nicht online. |
Diefenbach, S. and Zhang, X.* and Davis, R.H.* and Ratke, L. *University of Colorado, Boulder, USA, (1992) Numerical Simulation of Multi/particle Hydrodynamic Interactions in Liquid Dispersions. Proc. VIIIth European Symp.Materials and Fluid Sciences under Microgravity, ESA SP 333. Volltext nicht online. |
Dienhart, H. and Siegel, A. (Fichtner) (1992) Hydrogen Storage in Isolated Electrical Energy Systems with Photovoltaic and Wind Energy. Proc. 9th WHEC, Paris, 22nd - 25th June 1992. Volltext nicht online. |
Dienhart, H., Hille, G., (1992) Economic Analysis of Hybrid Systems for Decentral Electricity Generation in Developing Countries. In: Proc. 11th European Photovoltaic Solar Energy Conf., 12th - 16th October 1992, Montreux. Volltext nicht online. |
Dietrich, St. (1992) Improved DSMC-Modeling of Near-Continuum Flows with Chemical Reactions. In: Proc. of the 18th Symposium on Rarefied Gas Dynamics, Vancouver, Canada, 27.07.-31.07.1992. Volltext nicht online. |
Dlubek, G. and Krause, S. and Beresina, A.L. and Chuistov, K.S. and Welpmann, K. and Peters, M. (1992) Positron Annihilation Studies of Decomposition in Al-Li Base Alloys. In: Aluminium Lithium, M.Peters, P.-J. Winkler, Eds., pp. 63-68. DGM, Oberursel. Volltext nicht online. |
Dlubek, G, and Krause, S. and Krause, H. and Welpmann, K. and Peters, M. (1992) A Study of Precipitation Phenomena in Al-Li-Cu-Mg Alloys by Positron Annihilation and Transmission Electron Microscopy. In: Scripta Metallurgica et Materialia 26, pp. 1049-1054. Pergamon Press LTD.. Volltext nicht online. |
Dobrzynski, W. (1992) Moeglichkeiten zur Minderung des Propellerlaerms. Laermminderungsmassnahmen der Allgemeinen Luftfahrt, Bonn, 10.11.1992. Volltext nicht online. |
Dobrzynski, W. (1992) Sources of Aerodynamic Noise on Cars. Aeroakustik von Kraftfahrzeugen, Emmeloord, 16.11.1992-17.11.1992. Volltext nicht online. |
Dobrzynski, W. and Gehlhar, B. and Boettcher, J. (1992) Aeroacoustic Wind Tunnel Testing of a Counterrotating Shrouded Profan-Model. DGLR/AIAA 14th Aeroacoustics Conference, May 11th-14th, 1992, Aachen. Volltext nicht online. |
Dobrzynski, W. and Wiedemann, J. (1992) Generation of Aerodynamic Noise on a Sun Roof. Aeroakustik von Kraftfahrzeugewn, Emmeloord, 16.11.1992-17.11.1992. Volltext nicht online. |
Dodunekov, S.M. (1) and Nilsson, J.E.M. (1992) Parallel Decoding of the Golay (23,12,7) Binary Code. Intern. Workshop on Algebraic and Combinatorial Coding Theory, 22. - 28.6.92 in Voneshta Voda, Bulgarien. Vortr.: Nilsson. Volltext nicht online. |
Doergeloh, H. (1992) Untersuchungen zur Diskreten-Cosinus-Transformation von IR-Scenen. 15. Arbeitsgruppensitzung "Bildaufklaerung" des BMVG, Braunschweig, 12.-13.10.1992. Volltext nicht online. |
Doherr, K.-F. (1992) Trajectory Simulation Analysis. 2nd European Parachute Systems Technology Short Course of the University of Minnesota, Toulouse, France, 6 - 10 April 1992. Volltext nicht online. |
Doherr, K.-F. (1992) Rotating Parachutes. 2nd European Parachute Systems Technology Short Course of the University of Minnesota, Toulouse, France, 6 - 10 April 1992. Volltext nicht online. |
Doherr, K.-F. (1992) Trajectory Simulation Analysis and Software, Part I and II. 1992 Parachute Systems Technology Short Course of the University of Minnesota, Cocoa Beach, Florida, USA, 15 - 19 June 1992. Volltext nicht online. |
Doherr, K.-F. (1992) Parachute Design Case Study: Rotating Parachutes. 1992 Parachute Systems Technology Short Course of the University of Minnesota, Cocoa Beach, Florida, USA, 15 - 19 June 1992. Volltext nicht online. |
Doherr, K.-F. and Alvermann, K. (1992) 3D-Computer-Animation in Echtzeit mit Anwendung auf rotierende Submunition. CCG-Lehrgang LR 3.15 "Neue Entwicklungen im Bereich der Endphasenlenkung bei Lenkflugkoerpern und Geschossen", Braunschweig, 30.11.-04.12.1992. Volltext nicht online. |
Dressler, U. and Hansen, H. and Rill, S. and Horstmann, K. H. and Rohardt, C.-H,, and Wichmann, G. (1992) Design of the Fokker 100 Natural Laminar Flow Glove. In: DGLR/AAAF/RAeS Proceedings First Forum on Laminar Flow, pp. 152-163. DGLR, Bonn. Volltext nicht online. |
Duwe H., etal. (1992) Information Handling as Task Layer of Columbus User Support. In: Proceedings of Satellite Symposium 4, pp. 263-268. ESA Publications Division, ESTEC, Noordwijk, The Netherlands. International Space Year Conference, Munich, 30 March- 4 April 1992. Volltext nicht online. |
Däunert, U. (1992) Beitrag des Arbeit- und Technikprogrammes zur Gestaltung moderner Arbeits- und Produktionskonzepte. In: (Veröff. in Vorb.). Fachtagung Moderne Arbeits- und Produktionskonzepte, Bonn, 1. Oktober 1992.. Volltext nicht online. |
Däunert, U. (1992) Das Programm Arbeit und Technik in der Bundesrepublik Deutschland. In: (Proceed. in Vorb.). Deutsch-Französischer Workshop "Arbeit und Technik", Bonn, 14. September 1992.. Volltext nicht online. |
Däunert, U. (1992) Economy and Environmental Protection - A Contradiction in Terms? Interfinish '92, Sao Paulo, 8 October 1992.. Volltext nicht online. |
E
Eberius, H. (1992) Stabilisierung von Methan/Luft-Flammen bei hohen Druecken. Seminar am Institut für Physikalische Chemie der Universität Heidelberg (1992). Volltext nicht online. |
Eberius, H. (1992) Reaktionsdynamische Vorgaenge in Flammen bei verschiedenen Druecken. Wiss. Kolloquium des DLR-Instituts für Physikalische Chemie der Verbrennung, Stuttgart, Juni 1992. Volltext nicht online. |
Eberius, H. and Just, Th. and Koch, U. (1992) Determination of Burning Velocities of Curved Flamefronts. In: Proc. 6th Int. Symp. om Appl. of Laser Techniques to Fluid Mech. (1992). 6th International Symposium on Application of Laser Techniques to Fluid Mechanics, Lissabon, Portugal, 1992. Volltext nicht online. |
Eberius, H. and Just, Th. and Overhamm, M. (1992) Determination of Unburned Fuel in the Wall Boundary Layer of Methane/Air-Flames. In: Monitoring of Gaseous Pollutants by Tunable Diode Lasers (1992). Kluwer, Dordrecht, Boston, London. Volltext nicht online. |
Eberlein, D. (1992) Der Luftverkehr der Zukunft. Tagung Mensch-Verkehr-Umwelt, Bad Herrenalp, 24.-26.01.92. Volltext nicht online. |
Eberlein, D. (1992) Technikfolgenabschaetzung im Verkehr. VDI Baden, Karlsruhe, 25.06.92. Volltext nicht online. |
Eckler, K. and Cochrane, R.F. and Herlach, D.M. and Feuerbacher, B. and Jurisch, M. (1992) Non-Equilibrium Solidification in Undercooled Ni-B Alloys. In: Proceedings of the 8th European Symposium on Materials Sciences under Microgravity, 333, pp. 609-614. VIIIth European Symposium on Materials and Fluid Sciences in Microgravity, 1992-04-13 - 1992-04-17, Brüssel (B). Volltext nicht online. |
Eckler, K. and Cochrane, R.F. and Jurisch, M. and Herlach, D.M. (1992) Zwangsloesung von B in Ni durch schnelles Dendritenwachstum. DPG-Fruehjahrstagung Regensburg, 1992-03-16 - 1992-03-20, Regensburg (D). Volltext nicht online. |
Eggers, H. (1992) Extension of the ERR-concept, comparision with tests. Meeting of the Committee of Experts "Physical and Mathematical Aspects in Material Theory", Stuttgart, 27.-28.4. 1992.. Volltext nicht online. |
Eggers, H. (1992) Synergism between layer cracking and delaminations in multi- layered laminates of CFRE. AGARD-Specialists Meeting on "Debonding/Delamination of Composites". Patras/Greece, 25.-27.5.1992.. Volltext nicht online. |
Eggers, H. (1992) Ein erweitertes Konzept fuer die Energiefreisetzungsraten, Vergleich mit Versuchen. 5. Workshop "Composite-Forschung in der Mechanik", Universitaet Paderborn, 21.-22.10. 1992. Volltext nicht online. |
Egry, I. and Feuerbacher, B. (1992) Thermophysical properties of undercooled melts and their measurement in microgravity. In: Hydromechanics and Heat/Mass Transfer in Microgravity, pp. 275-278. Volltext nicht online. |
Ehret, G. and Kiemle, C. (Vortragender) and Renger, W. (1992) Airborne Remote Sensing of Tropospheric Water Vapor Using a Near Infrared DIAL System. In: Proc. Specialty Meeting on Airborne Radars and Lidars, pp. 111-116. Specialty Meeting on Airborne Radars andLidars, Toulouse, Frankreich, 6.-12.7.1992. Volltext nicht online. |
Ehret, G. and Kiemle, W.(Vortragender) and Renger, W. (1992) Airborne Remote Sensing of Tropospheric Water Vapor Using a Near Infrared DIAL System. Speciality Meeting on Airborne Radars and Lidars, 7.-10.7.92, Toulouse, Frankreich. Volltext nicht online. |
Ehret, G. and Renger, W. (Vortragender) (1992) LIDAR-Aerosolmessungen von der Transall. 2. Statusseminar des Ozonforschungsprogramms des BMFT, Bonn-Bad Godesberg, 25.-27.6.92. Volltext nicht online. |
Ehret, G. and Renger, W.(Vortragender) (1992) LIDAR/Aerosolmessungen von der Transall. 2. Statusseminar des Ozonforschungsprogramms des BMFT, Bonn-Bad Godesberg, 25.-27.6.1992. Volltext nicht online. |
Ehret, G.(Vortragender) and Kiemle, C. and Renger, W. and Simmet G., (1992) Airborne Remote Sensing of Tropospheric Water Vapor Using a Near Infrared DIAL System. In: Proc. 16th Intern. Laser Radar Conf., pp. 489-492. 16th Intern. Laser Radar Conf. Massachusetts Inst. of Technology, Cambridge, Mass., USA, 20.-24.7.92. Volltext nicht online. |
Eich, E. Fuehrer, C., (1992) Numerical Methods in Multibody Dynamies. In: Les methodes de caleul appliguees a la dynamigue des systemes multicorps. Imagine, Maison de la Productique Esplanade Diderot, F-43200 Roanne. Volltext nicht online. |
Eichert, H. and Kratzel, T. and Wetzel, F. (1992) Instationary High-turbulent Hydrogen Combustion Processes. In: Proc. 9th WHEC, Vol. 2, pp. 1181-1189. Proc. 9th WHEC, Paris, 22nd - 25th June 1992. Volltext nicht online. |
Eisenbeiß, G. (1992) Energy Supply Markets & Technologies. In: Proceedings 15, pp. 91-98. 25.-26. Mai 1992, Congress Centrum Hamburg. Volltext nicht online. |
Eisenbeiß, G. and Klaiß, H. and Nitsch, J. and Staiß, F. (1992) Einsatzmöglichkeiten solarthermischer Kraftwerke. 8. Internationales Sonnenforum der DGS, Berlin, 30.06.-03.07.1992. Volltext nicht online. |
Eisenbeiß, G. and Nitsch, J. and Klaiß, H. and Staiß, F. (1992) Einsatzmöglichkeiten solarthermischer Kraftwerke. In: Tagungsbericht des 8. Internationalen Sonnenforums, pp. 355-365. DGS-Sonnenenergie Verlags-GmbH, München. 8. Internationales Sonnenforum. Volltext nicht online. |
Eitelberg, G. and Fleck, B. and McIntyre, T.J. (1992) Holographic Interferometry on the High Enthalpy ShockTunnel in Goettingen (HEG). Volltext nicht online. |
Eitelberg, G. and McIntyre, T.J. and Beck, W.H. and Lacey, J. (1992) The High Enthalpy Shock Tunnel in Goettingen. Volltext nicht online. |
Eitelberg, G. Olivier, H., (1992) The High Enthalpy Facilities HEG and TH in Germany. Volltext nicht online. |
Elfert, M. (1992) Waermeuebergang in rotierenden Kuehlkanaelen von Gasturbinenschaufeln. In: Tagungsband des 3. Statusseminars der Arbeitsgemeinschaft Hochtemperatur-Gasturbine, 3.-4.12.1992, Sekr. AG Turbo, DLR-KP, pp. 43-57. 3. Statusseminar AG TURBO, 3.-4.12.1992, Köln-Porz. Volltext nicht online. |
Engel, K. and Faden, M. and Pokorny, S. (1992) Implementation of non-reflecting boundary conditionsin an unsteady flow siulations system. ICFD conference on numerical methods for fluid dynamics, 7.-10.04.92. Volltext nicht online. |
Engel, K. and Faden, M. and Pokorny, S. (1992) Randbedingungsforulierung fuer instationaere Innenstroemungsprobleme. Kolloquium Stroemungsmaschinen Universitaet Essen, 29.06.1992, Essen. Volltext nicht online. |
Engel, K. and Faden, M. and Pokorny, S. (1992) Numerical investigation of the unsteady flow through counterrotating fan. 18th ICAS Congress, 20.-25.09.1992, Peking, China. Volltext nicht online. |
Engel, K. and Faden, M. and Pokorny, S. (1992) Entwicklung eines 3-D Stroemungsloesers. DFG-Schwerpunktskolloquium 1992, Bad Godesberg. Volltext nicht online. |
Engel, K. and Faden, M. and Pokorny, S. (1992) Implementation of non-reflecting boundary conditions in an unsteady flow simulation system. ICFD Conference on Numerical Methods for Fluid Dynamics , 7.-10.04.92. Volltext nicht online. |
Engler, O. and Ponge, D. and Schelb, W. and Welpmann, K. and Peters, M. and Lücke, K. (1992) Investigations on Texture in Damage Tolerant 8090 Al-Li Sheet. In: Aluminium Lithium, M.Peters, P.-J. Winkler, Eds., pp. 333-338. DGM, Oberursel. Volltext nicht online. |
Engler, R. H. and Hartmann, K. (1992) Aerodynamic Assessment for an Optical Pressure Measurement System (OPMS) by Comparison with Conventional Pressure Measurements in a High-Speed Wind-Tunnel. DEA-Meeting "Windtunnels and Flight Simulation", TH Darmstadt, 22.-23. April 1992.. Volltext nicht online. |
Engler, R. H. and Hartmann, K. (1992) Bewertung eines neuen optischen Druckmessverfahrens (OPMS-S) durch Vergleich mit einer Standardmethode ueber Druckmessbohrungen. DLR-Zentrumskolloquium, Göttingen, 30.01.1992. Volltext nicht online. |
Ernst, G. (1992) Lean Production und Arbeit im Verkehr. Fachtagung Lean Production, Regionalentwicklung, Industriepolitik, Kassel, 1992. Volltext nicht online. |
Ernst, G. (1992) Arbeitsschutz und Praevention im Guetertransportsystem - das Beispiel Fahrer. In: Vortragstext erschienen in den RISP-Texten (1992) 7 S., 12 Lit.. Universität Duisburg - Gesamthochschule, 31. Januar 1992, Forschungsgruppe GTS, Kontinuität und Wandel.. Volltext nicht online. |
Ernst, G. and Kopp, I. (1992) Laufbahnentwicklung bei Berufskraftfahrern - Ideen und Ansaetze. Colloque Franco-Allemand anläßlich des VII Congres International de Psychologie du Travail de Langue Francaise, Straßburg, Juli 1992.. Volltext nicht online. |
Esch, H. and Niezgodka, J. and Kindler, K. (1992) Status of Facilities at Cologne; TMK, H2K and Modification of LBK. DEA-Meeting "Windtunnels and Flight Simulation", TH Darmstadt, 22-23 April 1992. Volltext nicht online. |
Esser, B. and Lenartz, M. (1) (1992) A New Method for the Numerical Simulation of Shock Tunnel Flows. EUROMECH 296 "Real gas effects in high enthalpy flows", 8-10 Sept. 1992, Goettingen. Volltext nicht online. |
F
Faden, M. and Pokorny, S. and Engel, K. (1992) A CFD Application on Transputer Systems. GAMM Seminar, Heidelberg. Volltext nicht online. |
Faden, M. and Engel, K. and Pokorny, S. (1992) TVD-Verfahren fuer instationaere Stroemungssimulation auf Transputern. Kolloquium Stroemungsmaschinen Universität Essen, 29.06.1992, Essen. Volltext nicht online. |
Faden, M. and Engel, K. and Pokorny, S. (1992) Instationaere Stroemungssimulation in Triebwerkskomponenten auf massiv parallelem Rechnersystem. Seminarvortrag GMB-Bonn, Bonn. Volltext nicht online. |
Faden, M. and Engel, K. and Pokorny, S. (1992) Numerische Simulation von Triebwerksstroemungen auf parallenen Rechnersystemen. COMETT Seminar, Industrielle Anwendung paralleler Computersysteme, Graz, Österreich. Volltext nicht online. |
Faden, M. and Pokorny, S. and Engel, K. (1992) Numerische Simulation von Triebwerksstroemungen auf parallelen Rechnersystemen. COMETT Seminar, Industrielle Anwendung paralleler Computersysteme, Graz, Oesterreich. Volltext nicht online. |
Faden, M. and Pokorny, S. and Engel, K. (1992) Instationaere Triebwerksstroemungen. Seminarvortrag, Universitaet Dortmund, Dortmund. Volltext nicht online. |
Farago, Z. and Krülle, G. and Mayer, W. and Schley C.A., (1992) Status of Coaxial Injector Modelling and Experiments at DLR Lampoldshausen. In: Proceedings 18th International Symposium on Space Technology and Science, Kagoshima, Japan, 1992. 18th International Symposium on Space Technology and Science; Kagoshima; Japan; 1992. Volltext nicht online. |
Fassbender, C. and Lorenz, B. and Goeters, K.-M. and Novikov, M. (1) and Gushin, V. (1) (1992) Proceedings of the Russian/German Workshop on Space Psychology. Volltext nicht online. |
Feuerbacher, B. and Egry, I. (1992) Containerless uncercooling of metals. In: Hydromechanics and Heat/Mass Transfer in microgravity, pp. 483-488. Volltext nicht online. |
Feuerbacher, B. and Egry, I. and Herlach, D.M. and Wittmann, K. (1992) Undercooling of Metals by Containerless Processing: A Novel Way to Access Metastable Thermodynamics. World Space Congress Washington, 28.8.-5.9.1992. Volltext nicht online. |
Fichtelmann, B. and Sonnemann, G. and Hartmann, G. (1992) Chaos - a possible characteristic in the diurnal variation of the ozone density in the mesopause region. XVII. Generalversammlung der Europäischen Geophysikalischen Gesellschaft (EGS) in Edinburgh/UK vom 06. - 10.04.1992. Volltext nicht online. |
Fiebig, U.-C. (1992) The Performance of Unconventional FFH/MFSK MA Systems with Ambiguity Resolution. In: Conf. Proceedings of the ISSSE'92, 1, pp. 52-55. Intern. Symp. on Signals, Systems and Electronics (ISSSE'92) 1. - 4. Sept. 1992, Paris, Frankreich. Volltext nicht online. |
Fiebig, U.-C. (1992) Unkonventionelle Frequenzsprungverfahren. Inst. fuer Exp. Mathematik der Univ.Essen, 25.3.92. Teil I und Teil II. Volltext nicht online. |
Fiebig, U.-C. (1992) Effizienz schneller Frequenzsprungverfahren mit Vielfachzugriff. Institutskolloquium in OP am 11.3.1992. Volltext nicht online. |
Fiebig, U.-C. (1992) Lineare und nichtlineare Sequenzen. CCG-Kurs "Kryptographie und Datensicherheit" IT-11.12 am 1.4.1992 in OP. Volltext nicht online. |
Filip, Pavel (1992) Pyramidenvektorquantisierung - Theorie und Anwendung. Fakultät für Mathematik und Informatik -Informatik-Kolloquium TU München, 11. Juni 1992. Volltext nicht online. |
Fischer, M. and Magens, E. and Winandy, A. (1992) Single-shot broadband nitrogen CARS measurement with temperatures up to 2900 K; Comparison of different data evaluation schemes. Posterpraesentation auf dem XI' th European CARS Workshop Florenz, 23.-25.k03.92. Volltext nicht online. |
Fischer, M. (1992) CARS-Aktivitaeten bei der DLR-Koeln. LIF 5 Meeting, 27.-28.09.1992, Lampoldshausen. Volltext nicht online. |
Fischer, M. (1992) First N2-measurements up to approximately 3100 K at the DLR- Cologne. Meeting HERMES diagnostic group, , 24.02.92, Köln-Porz. Volltext nicht online. |
Fischer, M. and Magens, E. and Winandy, A. (1992) Single-shot broadband nitrogen CARS measurements with temperature up to 3200K: Comparison of different data evaluation shemes. In: World Scientific Publishing Co Pte Ltd, Singapore. XI`th European CARS Workshop, 23.-25.03.1992, Florence, Italy. Volltext nicht online. |
Fischer, Michael and Magens, Eggert and Winandy, Adi (1992) Single-Shot Broadband Nitrogen CARS Measurements with Temperatures up to 3200 K: Comparison of Different Data Evaluation Schemes. In: Coherent Raman Spectroscopy: Applications and New Developments, pp. 165-170. World Scientific Publishing Co. Pte. Ltd.. XI'th European CARS Workshop, 1992-03-23 - 1992-03-25, Florence (Italy). ISBN 981-02-1125-2. Volltext nicht online. |
Fischer, Th. M. (1992) Zur nichtlinearen Entwicklung von Stoerungen in Grenzschichten. GAMM-Jahrestagung, Leipzig 24.-28.03.1992. Volltext nicht online. |
Fleck, B. and McIntyre, T.J. and Eitelberg, G. (1992) Holographische Interferometrie am Hoch-Enthalpie-Windkanal (HEG). Jahrestagung DGaO 1992. Volltext nicht online. |
Focke, H. (1992) Regional- und Reisezweckstruktur der Luftverkehrsnachfrage der Bundesrepublik Deutschland. Arbeitskreis Marktforschung und Statistik der Arbeitsgemeinschaft deu tscher Flughaefen, Wien, 17.11.1992. Volltext nicht online. |
Frank, P. (1992) Investigation of the High Temperature Reaction Phenyl + Acetylene. In: Proc. Int. Workshop "Mechanisms and Models of Soot Formation" (1992). Springer-Verlag Heidelberg. International Workshop "Mechanisms and Models of Soot Formation", Heidelberg 29.09.-2.10.91. Volltext nicht online. |
Frank, P. (1992) Untersuchungen zur Hochtemperaturoxidation von Phenyl. Kolloquium Fachbereich Maschinenbau der Univ. Duisburg, 16.11.1992. Volltext nicht online. |
Frank, P. (1992) Neue Ergebnisse zu Hochtemperaturreaktionen im Stoßwellenrohr. Wissenschaftliches Kolloquium anläßlich des 60. Geburtstages von T. Just, Stuttgart, 4. Juni 1992. Volltext nicht online. |
Franke, J. (1992) Die DFVLR / DLR Modell des Industrieroboters Manutec r3. TU Magdeburg, 06.01.92. Volltext nicht online. |
Freeman, A. *) (Vortragender) and Moghaddam, M. *) and Zink, M. and Zebker, H.*) *) JPL, Pasadena, USA, (1992) Radiometric Correction of SAR Images of Varying Terrain Heights. IEEE, Piscataway, N.J.. Vortrag, gehalten auf: IGARSS '92, Houston, Texas, USA, 26.-29.5.92 Proc. IEEE Cat.Nr.92 CH 3041-1, 1992, Vol. I. Volltext nicht online. |
Frey-Buness, A. (1992) Regionalisierung globaler Klimaaenderungen fuer den Alpenraum. In: Ann. Meteorol. (NF). Deutsche Meteorologen-Tagung 1992, Berlin, 16.-20.3.1992. Volltext nicht online. |
Frey-Buness, A. and Heimann, D. and Sausen, R. and Schumann, U. (1992) Regionalisation of Global Climate Changes for the Alpine Region. Second Intern. Conf. on Modelling of Global Climate Change and Variability, Hamburg, 7.-11.9.92. Volltext nicht online. |
Frey-Buness, A.(Vortragende) and Heimann, D. (1992) Regionalisierung globaler Klimaaenderungen fuer den Alpenraum. Zweite Deutsche Klimatagung, Neubrandenburg, 28.-31.10.91. Volltext nicht online. |
Froevel, M. (1992) High temperature resistent composite structures with glass matrix. International Symposiumon Advanced Material for lightweight Structures, ESA/Brite/Euram Eureka, Noordwijk, Niederlande, 25.-27.3. 1992.. Volltext nicht online. |
Froevel, M. (1992) High temperature resistent structures with glass matrix. SAPE 92, Advanced Materials and Structures from Research to Application. Society for Advancement of Material and Process Engineering, Hamburg, 8.-13.5. 1992.. Volltext nicht online. |
Froevel, M. (1992) Verbundwerkstoffe fuer Temperaturen oberhalb 600 Grad Celsius. Gesellschaft Deutscher Chemiker/Demozentrum, BS, Fortbildungsk.624/92 "Leichtbau mit Verbundwerkstoffen im Verkehrswesen" Braunschweig, 6.-7. 10. 1992. Volltext nicht online. |
Fuchs, W.(*)(Vortragender) and Schickel, K.P.(Poster) (1992) Computer-Assisted Aircraft Icing Forecast: Experiences during Winter 1990/91. In: Proc. 11th Intern. Conf. on Clouds and Precipitation, pp. 1126-1127. 11th Int. Conf. on Clouds and Precipitation, Montreal, Canada, 17.-21. August 1992. Volltext nicht online. |
Fuerstenau, N. and Janzen, D. and Schmidt, W. (1992) Flight Tests of a Fiber Optic Interferometric Strain Gauge. In: SPIE, P.O. Bos 10, Bellingham, Washington, USA. SPIE Conference "Fiber optic Smart Structures and Skins V", Boston, September 92. Volltext nicht online. |
Fuerstenau, N. and Janzen, D. and Schmidt, W. (1992) Fiber-Optic Interferometric Strain Gauge for Smart Structures Applications: First Flight Tests. 75th Meeting of the AGARD Structures and Mareials Panel "Smart Structures for Aircraft and Spacecraft", Lindau, 7.-9.10.92. Volltext nicht online. |
Fuerstenau, N. and Schmidt, W. and Goetting, H.-C. (1) (1992) Fiber-Optic Inferrometrie Strain Gauge for "Smart Structures". In: VDI Bericht Nr. 939, pp. 213-218. Sensoren-Technolgie und Anwendungen, Bad Nauheim, 16.-18.3.92. Volltext nicht online. |
Fuerstenau, N. and Schmidt, W. and Goetting, H.-C. (1) (1992) Remote Fiber-Optic Strain Sensing on Composites with Simultaneous Inferometric and Polarimetric Readout. In: Proc. Optic Fiber Sensors 92 (1992) pp. 113-116, pp. 113-116. 8th Optical Fiber Sensors Conference, Monderey, Cal., 29.-31.01.92. Volltext nicht online. |
Fuerstenau, N. and Schmidt, W. and Goetting, H.-C. (1) (1992) Composite Strain Sensing wiht a Combined Interferometric and Polarimetric Fiber-Optic Strain Gauge. In: Adam Hilger, Institute of Physics (IOP) Publishing Ltd, Bristol, England, pp. 81-84. First European Conference on Smart Structures and Materials, Glasgow, 12.-14.5.92. Volltext nicht online. |
Funken, K.-H. (1992) Solar chemistry: routes to utilize solar energy in industrial chemistry. In: Proceedings Fourth World Congress of Chemical Engineering Strategies 2000, Karlsruhe, 16th - 21st June, 1991, pp. 544-549. Dechema, Frankfurt/Main. Volltext nicht online. |
Funken, K.-H. (1992) Die Umsetzung solarer Photoreaktionen im Technikumsmassstab. In: Tagungsbericht Bd. 2, 8. Internationales Sonnenforum, Berlin, 30. Juni - 3. Juli 1992, pp. 1377-1382. DGS-Sonnenenergie Verlags-GmbH, Muenchen. Volltext nicht online. |
Funken, K.-H. (1992) F&E-Arbeiten der DLR am Hochflussdichte-Sonnenofen. 7. Sitz. d. Schwerp. Solare Chemie u. Solare Materialuntersuchung der AG-Solar NRW, Muelheim/Ruhr, 14.10.92. Volltext nicht online. |
Funken, K.-H. (1992) Report on German Activities in Solar Chemistry. IEA SolarPACES, Task 2, working group meeting Tabernas/Almeria, 22nd Sept. 1992. Volltext nicht online. |
Funken, K.-H. (1992) Solar Photochemical and Photocatalytic Systems. 5th International Summer School "Solar Energy 92" Klagenfurt, Oesterreich, 11th - 21st August 1992. Volltext nicht online. |
Funken, K.-H. (1992) Die Umsetzung solarer Photoreaktionen im Technikumsmassstab. 8. Internationales Sonnenforum, Berlin, 30.06. - 03.07. 92. Volltext nicht online. |
Funken, K.-H. (1992) Status und Perspektiven solarer Photoreaktionen. SOTA-Abschlusspraesentation, Koeln, 10. u. 11.06.92. Volltext nicht online. |
Funken, K.-H. (1992) Status und Perspektiven solarer thermochemischer Prozesse. SOTA-Abschlußpräsentation, Köln, 10. und 11.06.1992. Volltext nicht online. |
Funken, K.-H. (1992) Die techn. Nutzung der Solarstrahlung zur Behandlung und Entgiftung von Abfaellen und Abwaessern sowie zur Trinkwasseraufbereitung. DECHEMA, Jahrestagung 1992 Karlsruhe, 3.-5.06.92. Volltext nicht online. |
Funken, K.-H. (1992) Solare Chemie: Wege zur Nutzung der Solarenergie in der Chemischen Technik. In: Internationales Symposion: Wasserstofftechnologie im Rahmen der ACHEMA 1991, Frankfurt/Main. Volltext nicht online. |
Funken, K.-H. (1992) Solare Chemie - Eine Junge, Attraktive Disziplin zur Nutzung erneuerbarer Energien. Solartechnik. Region-Koeln - der Brennpunkt" IHK Koeln 07.06.91. Volltext nicht online. |
Funken, K.-H. (1992) Wege zur Nutzung konzentrierender Solaranlagen in der Chemie. Institut f. Physik. und Theor. Chemie d. Techn. Uni Carolo-Wilhelmina zu Braunschweig, 11.01.1991.. Volltext nicht online. |
Funken, K.-H. and Esser, E.P. and Scharf, H.-D. (RWTH Aachen), Esser, P., and RWTH Aachen), Woehrle, I. (RWTH Aachen), (1992) The SOLARIS-Experiment: Demonstration of Solar-Photochemical Syntheses of Fine Chemicals. 6th International Symposium on Solar Thermal Concentrating Technologies, Mojacar, Spain, 28th Sept. - 2nd Oct.,. Volltext nicht online. |
Funken, K.-H. and Romero, M. (1992) Application 2 - Solar Chemistry. PSA Program Review, 26th - 27th Oct. 1992, Almeria, Spain. Volltext nicht online. |
Funken, K.-H. and Schneider, G. (1992) Ziele, Aufgaben und Hauptresultate des SOTA-Arbeitspaketes "Wissenschaftliche Begleitung". SOTA-Abschlusspraesentation, Koeln, 10./11.06.92. Volltext nicht online. |
Förster, M. and Jakowski, N. and Mikhailow, A.V. and Smilauer, J. and Schlegel, K. (1992) Studies of geomagnetic storm periods observed vy the "Activny" satellite mission in the upper ionosphere/Lower plasmasphere. XVII; Generalversammlung der Europäischen Geophysikalischen Gesellschaft (EGS) in Edingburgh/UK vom 06.-10.04.1992. Volltext nicht online. |
Füllekrug, U. (1992) Einfuehrung in die experimentelle Modalanalyse - Grundlagen der Strukturdynamik - a) Einfuehrung b) Aufbau des Rechenmodells c) Freie Schwingungen - Eigenverhalten d) Erzwungene Schwingungen e) Das Phasenresonanzverfahren f) Experimentelle Bestimmung modaler Parameter im Zeitbereich. Seminar DR 1.01 der Carl-Cranz-Gesellschaft: "Experimentelle Modalanalyse - Ein modernes Hilfsmittel zur Loesung strukturdynamischer Probleme", Goettingen, 18.-21.05.1992.. Volltext nicht online. |
G
Gabler, B. (1992) A Programmable Pulse Expander for Airborne Synthetic Aperture Radar Applications. Vortrag, gehalten auf: Speciality Meeting on Airborne Radars and Lidars at: Centre National de Recherches Meteorologiques (CNRM)/METEO FRANCE, Toulouse, France, 7-10 July 1992.. Volltext nicht online. |
Gaedke, M. (1992) The map of the world of composites. Besuch einer Fachjournalistengruppe bei der DLR, Koeln, 25.2. 1992.. Volltext nicht online. |
Gaedke, M. (1992) Werkstoffe und Werkstoffkennwerte. Carl-Cranz-Ges. CCG, Lehrgang BW 2.02, "Strukturmechanische Berechnung im Leichtbau mit Faserverbundwerkstoffen", Braunschweig, 11.5.-15.5. 1992.. Volltext nicht online. |
Gaedke, M. (1992) Berechnung und Konstruktion von Bauteilen aus Faserverbundwerkstoffen. Tagung Nr. T-30-843-111-2 "Neuere Entwicklungen auf dem Gebiet der Verbundwerkstoffe" Haus der Technik, Essen 27.-28.10. 1992.. Volltext nicht online. |
Gaedke, M. (1992) The map of the world of composites. Besuch einer Fachjournalistengruppe bei der DLR Koeln, 25.2. 1992.. Volltext nicht online. |
Gaedke, M. (1992) Structural aspects of composite materials, properties, analysis, damage mechanics. (Penary Paper). Fifth European Conference on Composite Materials (ECCM-5) Bordeaux/Frankreich, 7.-10.4. 1992.. Volltext nicht online. |
Gaedke, M. (1992) Analytical and experimental approach to cumulative damage and residual strength prediction for CFRE composites. 6th PCC-Meeting, Progress Report for BE 3444-Project. Stuttgart, 27.-29.4. 1992.. Volltext nicht online. |
Gaedke, M. (1992) GARTEUR damage mechanics for composite materials. In: Analytical/experiemntal research on delaminations.. AGARD Specialists Meeting on Debonding/Delamination of Composites. Patras/Greece, 25.-27.5. 1992.. Volltext nicht online. |
Gaedke, M. (1992) Cumulative damage under service conditions. Mid-Term-Review for BE 3444-project, Genua/Italien, 9.-11.9.1992.. Volltext nicht online. |
Gaedke, M. (1992) Damage mechanics in the institute of structural mechanics. In: A Review. 3rd GARTEUR-Meeting, "Damage Propagation in Composite Structural Elements", Farnborough/England, 17.-19.9. 1992.. Volltext nicht online. |
Gaedke, M. (1992) The institute of structural mechanics in the research field of the German aerospace research establishment. Lecture at the BUAA, Peking/China, 25.9. 1992.. Volltext nicht online. |
Gaedke, M. (1992) Damage mechanics of fibre composites at the institute of structural mechanics of the DLR. Lecture at the BUAA. Peking/China, 26.9. 1992.. Volltext nicht online. |
Gaedke, M. (1992) The institute of structural mechanics in the research field of the German aerospace research establishment. Lecture at the CAE/ASRI, Yaoxian/China, 28.9. 1992. Volltext nicht online. |
Gaedke, M. (1992) Interlaminar fracture toughness parameters for delamination growth in CFRE-composites. In: Experiments and analysis.. Lecture at CAE/ASRI, Yaoxian/China, 29.9. 1992. Volltext nicht online. |
Gaedke, M. (1992) Contributions of DLR-IFSM to BRITE/EURAM - Project 3444 cumulative damage and residual strength prediction for CFRE composites. 8th PCC-Meeting, Progress Report for BE 3444-Project, Bruessel/Belgien, 17.-18.10.1992.. Volltext nicht online. |
Gaedke, M. (1992) Schadensmechanik von gekerbten CFK-Laminaten. In: FEM-Analyse/Versuchsergebnisse. Universitaet Gesamthochschule Duisburg, 30.11. 1992. Volltext nicht online. |
Gebhard, J. (1) et.al. (1992) Bistabiles Verhalten einer Eis-/Mineralmischung bei Bestrahlung: Variation der Emission als Funktion der Mantel-Bildung. AEP-Fruehjahrstagung der Deutschen Phys. Ges. 30.3.-2.4.1992, TU Berlin. Volltext nicht online. |
Gebing, H. (1992) Numerische Simulation und topologisch-physikalische Analyse der instationaeren, dreidimensionalen, abgeloesten Wirbelstroemungen an einer Kugel und an Rotationsellipsoiden. Stroemungsphysikalisches Seminar, 1. Dez. 1992, MPI Goettingen. Volltext nicht online. |
Gebing, H., Vollmers, H., Dallmann, U., (1992) Numerische Simulation and Analyse der instationaeren, dreidimensionalen, abgeloesten Wirbelstroemungen an einer Kugel und an Rotationsellipsoiden. 8. DGLR-Fach-Symposium, Stroemungen mit Abloesung, Koeln-Porz, 10.-12. Nov. 1992. Volltext nicht online. |
Geier, B. (1992) Verbunde unter Membranbeanspruchung. Carl-Cranz-Ges.CCG, Lehrgang BW 2.02, "Strukturmechanische Berechnung im Leichtbau mit Faserverbundwerkstoffen", Braunschweig, 11.5.-15.5. 1992.. Volltext nicht online. |
Geier, B. (1992) Balken mit mehrzelligen Hohlquerschnitten. Carl-Cranz-Ges. CCG, Lehrgang BW 2.02, "Strukturmechanische Berechnung im Leichtbau mit Faserverbundwerkstoffen"' Braunschweig, 11.5.-15.5. 1992.. Volltext nicht online. |
Geier, B. (1992) Schichtenverbunde unter Membran- und Biegebelastung. Carl-Cranz-Ges. CCG, Lehrgang BW 2.02, "Strukturmechanische Berechnung im Leichtbau mit Faserverbundwerkstoffen"' Braunschweig, 11.5.-15.5. 1992.. Volltext nicht online. |
Geier, B. (1992) Beruecksichtigung von Temperatur und Feuchteaenderung in der Schichtentheorie. Carl-Cranz-Ges. CCG, Lehrgang BW 2.02, "Strukturmechanische Berechnung im Leichtbau mit Faserverbundwerkstoffen", Braunschweig, 11.5.-15.5. 1992.. Volltext nicht online. |
Geier, B. (1992) Beulverhalten von Platten und Schalen: Ueberblick, Grundlagen. Carl-Cranz-Ges. CCG, Lehrgang BW 2.02, "Strukturmechanische Berechnung im Leichtbau mit Faserverbundwerkstoffen", Braunschweig, 11.5.-15.5. 1992.. Volltext nicht online. |
Geier, B. (1992) Computation of buckling loads of thin anisotropic cylinders and panels based on analytical solution. International Conference on Computaional Engineering Science, ICES '92, Hongkong, 17.12. 1992.. Volltext nicht online. |
Geißler, W. and Vollmers, H. (1992) Unsteady Separated Flows on Rotor-Airfoils - Analysis and Visualization of Numerical Data -. September 15-18, 1992, Avignon, France. Volltext nicht online. |
Geißler, W. and Vollmers, H. (1992) Unsteady Separated Flows on Rotor-Airfoils - Analysis and Visualization of Numerical Data -. Vortrag: September 15-18, 1992, Avignon, France. Volltext nicht online. |
Gekat, F. and Klingenberg, H.H. (1992) Design of Microwave Pulse Compression Circuits for the Excitation of Pulsed High Power Gas Lasers. 11th Intern.Power Modulator Symp., Myrtle Beach, South Carolina, June 23-25, 1992. Volltext nicht online. |
Gelhaar, B. and Alvermann, K. and Dzaak, F. (1992) A Multichannel Data Acquisition System Based on Parallel Processor Architecture. In: Proceedings of the International Telemetering Conference, San Diego, CA, USA, 22 - 28 October 1992, pp. 17-29. Volltext nicht online. |
Gerz, T. (1992) Research Activities at the Institute of Atmospheric Physics at DLR. Seminarvortrag bei EDF, Chatou/France, 4.6.92. Volltext nicht online. |
Gerz, T. (1992) Homogeneously Sheared and Stratified Turbulence - The state of the Art -. PEPIT - Seminar on Stratified Turbulence, EdF Chatou/France, 22. October 1992. Volltext nicht online. |
Gerz, T. (1992) Zur Ausbreitung von Emissionen vom Flugzeug bis zur globalen Skala. DFG-Kolloquium zum Schwerpunkt "Grundlagen der Auswirkungen der Luft- und Raumfahrt auf die Atmosphäre", München, 9.-10.3.92. Volltext nicht online. |
Gieß, P.-A. (1992) The Wind Tunnel for Straight Cascades at DLR Göttingen a) construction and data acquisition b) some results of recent investigation. 18.8.92 Beijing; Beijing Univ.of Aeronautics and Aerospace, 27.8.92 Jiangyou; CAE, Gasturbine Establishment, 7.9.92 Nanjing; Nanjing Aeronautical Institute. Volltext nicht online. |
Gilbert, N.(1), Kleiser, L., (1992) Turbulence Model Testing with the Aid of Direct Numerical Simulation Results. In: Proc. Eighth Symposium on Turbulent Shear Flows, Munich, Sept. 9-11, 1991. Volltext nicht online. |
Glitz, R. (1992) The Use of Polarimetric Multifrequency SAR for Characterizing Terrain Classes. Vorgetragen, auf European 'International Space Year" Conference 1992, Munich, 30.3.-4.4.92 Proc. of the Central Symp. of the 'Internat. Space Year' Conf. ESA SP-341, July 92. Volltext nicht online. |
Gmelin, B. (1992) Entwicklungsrichtungen. CCG-Lehrgang LR 2.01 "Einfuehrung in die Hubschrauber-Technik", Oberpfaffenhofen, 19.-23.10.1992. Volltext nicht online. |
Goebel, W. (1992) Das deutsche Seenotrufsystem: Entwicklung und Einsatz von satellitengestuetzten Funkbojen (1,6 GHz-EPIRB). DLR-Zentrumskolloquium in Braunschweig am 13.2.1992. Volltext nicht online. |
Goeters, K.-M. and Adam, N. (1992) The Establishment of European Standards for the Psychological Evaluation of Pilots. In: Kongreßbericht der WEAAP-Tagung. WEAAP-Tagung, Nizza, Frankreich, 14.-18.10.1991. Volltext nicht online. |
Goh, Ch.-H. (1) and Grübel, G. (1992) Synthesis of Robust Multivariable Controllers for Large Flexible Structures. In: Proc. Symposium on Automat. Control in Aerospace. IFAC Symposium on Automat. Control in Aerospace, Muenchen, 08.-11.09.92. Volltext nicht online. |
Graf, J. and Schumann, U. (1992) Simulation of the Convective Boundary Layer in Comparison to Aircraft-Measurements. In: Proc. of Int. Technical Meeting of NATO-CCMS on Air Pollution Modelling and its Application IX, 17, pp. 587-593. Plenum Press, New York, USA. Volltext nicht online. |
Grotheer, H.H. (1992) Radikal-Radikal-Reaktionen im Stroemungsreaktor. Festkolloquium aus Anlaß des 60. Geburtstages von Prof. Dr. Just, Stuttgart, Juni 1992.. Volltext nicht online. |
Gruener, K. and Kahlisch, G. and Schreiber, H. and Sliwinski, P. and Vowinkel, B. *) (Vortragender) (1992) A New Passive Microwave Linescanner for Airborne Measurements of Maritime Oil Pollutions. 1992 IEEE-MTT-S International Microwave Symposium, Albuquerque, New Mexico, USA, 1-5 June 1992. Volltext nicht online. |
Grunwald, A. (1992) Technology Assessment of Human Space Flight: Combining Normative Ethics and Systems Analysis to Assist Decision-Making. Technology and Democrazy, 3rd European Congress on technology Assessm ent Copenhagen, 7.11.92. Volltext nicht online. |
Grunwald, A. and Weckwerth, G. and Fromm, J. (1992) Technikfolgenbeurteilung zukuenftiger bemannter Raumfahrt: Zielsetzungen, die Rolle des Menschen und Handlungsalternativen. DGLR-Jahrestagung 1992, Bremen. Volltext nicht online. |
Grunwald, G. (1992) Integration, Fusion und Planungen in der Multisensordatenverarbeitung. In: Reihe Informatik Aktuell; Information als Produktionsfaktor, pp. 354-363. Springer Verlag, Heidelberg. Volltext nicht online. |
Grunwald, G. and Hager, G.D. (1) (1992) Towards Task-Directed Planning of Cooperating Sensors. In: Proc. SPIE OE/Technology: Sensor Fusion V. SPI OE/Technology: Sensor Fusion V; Conf. 1828 Boston, Mass. USA, 15.-19.11.92. Volltext nicht online. |
Grupp, Friedemann (1992) Studie zur Parameteridentifizierung nichtlinearer Komponenten am Beispiel einer Radaufhaengung. Workshop Identifizierung-, Analyse- und Entwurfsmethoden für mechanische Mehrkoerpersysteme in Deskriptorform, Paderborn, 16.03.-19.03.92. Volltext nicht online. |
Grübel, G. (1992) Regelungstheorie I. Vorlesungen Ruhr-Universitaet Bochum, 15./16.06.92; 29./30.06.92; 06./07.07.92. Volltext nicht online. |
Grübel, G. (1992) AnDeCS: a Concurrent Control Engineering Project. In: Proc. IEEE CACSD'92 Symposium, pp. 39-47. IEEE CACSD'92 Symposium, Napa, CA, USA, 17.-19.03.92. Volltext nicht online. |
Grübel, G. (1992) Robust Low-Order Control of a Generic Flexible Test Structure. In: Proc. 1st IEEE Conference on Control Applications. 1st IEEE Conference on Control Applications Dayton, Ohio, 13.-16.09.92. Volltext nicht online. |
Grübel, G. and Bals, J. and Finsterwalder, R. and Gramlich, G. and Joos, H.-D. and Otter, M. (1992) Computer-Integrated Control-Dynamics - Design Experimentation by ANDECS R. ESA Workshop Spacecraft Guidance Navigation and Control Systems Software for Design and Implementation, Noordwijk, 29.09.-01.10.92. Volltext nicht online. |
Grübel, G. and Kortüm, W. (1992) Towards a Coherent Technology for Computational Vehicle Dystem Dynamics. In: Proc. AVEC'92, International Symposium on Advanced Vehicle Control. AVEC'92, International Symp. on Advanced Vehicle Control, Yokohama, Japan, 14.-17.09.92. Volltext nicht online. |
Grübel, G, and Bals, J. (1992) Component Interfaces by Example of ANDECS. In: IEE Colloquium "Open systems: the way forward in computeraided control engineering". London, 15. Dez. 1992. Volltext nicht online. |
Grünhagen, W. von (1992) Grundlagen der Modellierung von Hubschraubern. Physikalische Phaenomene. Mathematische Beschreibung. CCG-Lehrgang LR 11.01 "Flug- und Systemsimulation", Braunschweig, 23.-27.03.1992. Volltext nicht online. |
Grüninger, G. (1992) Faserverbundwerkstoffe - Übersicht/Anwendung/Technologie/Fertigung. Bosch-Kolleg, Stuttgart, 9. Nov. 1992. Volltext nicht online. |
Grüninger, G. (1992) Einführung und Übersicht in die Thematik der wiss. Beiträge aus der Sicht des wiss. Leiters dieser Konferenz ( Vorwort ). Verbundwerk 92; 4th Int. Conf. on Reinforced Materials and Composite Technologies; Wiesbaden, July 1-3,1992. Volltext nicht online. |
Gundlach, G. and Dankert, C. (1992) Nonintrusive Temperature Determination by LIF in Hypersonic Wind Tunnels. Workshop on "New Trends in Instrumentation for Hypersonic Research", 27.4.-1-.5.92, ONERA, Le Fauga-Mauzac Center/France.. Volltext nicht online. |
Gädke, M. (1992) Die Bedeutung der Grenzschicht Faser-Harz bei der Rißentstehung und Rißausbreitung in CFK-Laminaten. 7. Sitzung des DGM-Fachausschusses "Gefüge und Eigenschaften von Polymerwerkstoffen" DASA, Deutsche Airbus GmbH, Bremen, 23.11.1992. Volltext nicht online. |
Gülhan, A. and Kindler, K. (1992) The Upgrading of the Arc Heated Wind-Tunnel of the DLR (LBK) with Respect to its Effects on the Material Testing. Symposium on "Theoretical and Experimental Methods in Hypersonic Flows" in Torino, Italy; 4-8 May 1992. Volltext nicht online. |
Gülhan, A. and Kindler, K. and Koch, U. and Devezeaux, D. and Sagnier, Ph. (1992) High Enthalpy Experiments in LBK and Comparison with Numerical Simulations. EUROMECH 296: "Real gas effects in high enthalpy flows, 8-10 Sept. 1992, Göttingen. Volltext nicht online. |
Gülzow, E. and Holzwarth, B. and Schnurnberger, W. and Schulze, M. and Steinhilber, G. (1992) PTFE-Bonded Gas Diffusion Electrodes for Alkaline Fuel Cells. In: Proc., Vol. 3, pp. 1507-1514. Proc. 9th WHEC, Paris, 22nd - 25th June 1992. Volltext nicht online. |
Gülzow, Erich and Schulze, Mathias and Holzwarth, Birgit and Schnurnberger, Werner (1992) Aktivierungs- und Degradationsuntersuchungen bei Gasdiffusionselektroden für alkalische Brennstoffzellen. In: DPG-Frühjahrstagung 1992. DPG-Frühjahrstagung 1992, Berlin. Volltext nicht online. |
H
Haertel, C. (1992) Feinstrukturmodellierung fuerLES wandbegrenzter turbulenter Scherstroemungen. Seminarvortrag, TU Muenchen, 17.11.1992. Volltext nicht online. |
Haertel, C., Kleiser, L. (Vortragender), (1992) Subharmonic Transition to Turbulence in Channel Flow. Fourth European Turbulence Conference, Delft, June 30 - July 3, 1992. Volltext nicht online. |
Hagemann, G. and Manski, G. (1992) Parametrische Untersuchungen der Verlusteffekte von Raketenduesen. In: DGLR-Jahrbuch 1992. DGLR-Jahrestagung; Bremen; 1992. Volltext nicht online. |
Hagenauer, J. (1992) Mehrstufige digitale Mobilfunkempfaenger mit Zuverlaessigkeitsinformation. Kolloquium Informationstechnik, TU Muenchen, 21.2.1992. Volltext nicht online. |
Hagenauer, J. (1992) Advanced Methods for Satellite and Deep Space Communications. In: Proc. of an Intern. Seminar organized by DLR, Bonn, Sept, 1992. Springer-Verl., Lecture Notes in Control and Inform. Sciences 182. Volltext nicht online. |
Hagenauer, J. (1992) Source-Controlled Channel Decoding with Application to Mobile Communications. 1. Rensselaer Polytechnic Institute, 22.10.92, Troy, N.Y., USA 2. General Electric Research Lab., 23.10.92, Schenectady, N.J., USA 3. AT&T Bell Labs., 26.10.92, Murray Hill, N.J., USA 4. Winlab. Rutgers Univ., 27.10.92, Piscataway, N.J., USA. Volltext nicht online. |
Hager, G.D. (1) and Grunwald, G. (1992) Sensor Planning for Reactive Robotic Systems. In: Proc. The Allerton Conference on Computing, Control and Communications. The Allerton Conf. on Computing, Control and Communications, University of Illinois, USA, 02.10.92. Volltext nicht online. |
Hahn, K.-U. (1992) Beitraege zur Realisierung eines Gust-Management-Systems. In: DGLR-Jahrbuch 1992. Deutscher Luft- und Raumfahrt-Kongress 1992, Bremen, 29.09.-02.10.1992. Volltext nicht online. |
Hahn, K.-U. and König, R. (1992) LARS - Auslegung und Erprobung eines fortschrittlichen Boeenabminderungssystems mit ATTAS. In: DGLR-Jahrbuch 1991, Band II, pp. 950-963. Volltext nicht online. |
Hahn, K.-U. and König, R. (1992) ATTAS Flight Test and Simulation Results of the Advanced Gust Management System LARS. In: Proceedings of the AIAA Atmospheric Flight Mechanics Conference, Hilton Head, SC, USA, 10 - 12 August 1992. Volltext nicht online. |
Hahn, W. and Krichbaumer, W. and Streicher, J. and Werner, Ch. (1992) Dense Fog on the Highway Visual Range Monitoring in Cars? 16th International Laser Radar Conference, Cambridge, Massachusetts USA, 20-24 July 1992. Volltext nicht online. |
Hald, H. (1992) Lightweight CFRP Frame Structures for A ROTEX-Derived Manipulator System. Int. Symp. on Advanced Materials for Lightweight Structures; ESTEC, Noordwijk / NL; 25-27 March 1992. Volltext nicht online. |
Hald, H. (1992) Leichtbaustrukturen fuer Roboter. Bauweisen-Kolloquium, DLR-Stuttgart 10.Sept. 92. Volltext nicht online. |
Hald, H. (1992) Die Entwicklung thermomechanischer hochbelastbarer Faserkeramikbauteile aus C/SiC. Faserkeramikwerkstoffe - Eigenschaften und Anwendungen; Seminar Carl-Cranz-Ges.; DLR-Stuttgart, 24./25.11.1992.. Volltext nicht online. |
Hamacher, H. (1992) Spacecraft low frequency residual acceleration. 43. IAF Congress, Aug. 28./ Sept. 5, 1992, Washington, DC. Volltext nicht online. |
Hamacher, H. (1992) The microgravity environment in a space laboratory. 6. Microgravity Summer School Schellenberg, 6.-9.7.1992. Volltext nicht online. |
Hamacher, H. and Stark, H. and Knott, K. and Merbold, U. and Jilg, R. (1992) Microgravity Measurement Assembly, an advanced measurement system for Spacelab. 1. ESA/CNES Symposium "Space Microdynamics and Accurate Control", 30.-Dec. 3, 1982, Nice, France. Volltext nicht online. |
Hamel, P. (1992) Recent Advances in Flight Mechanics Research at the DLR Institute for Flight Mechanics. DLR-Presentation at the University of Glasgow, Glasgow, UK, 26 October 1992. Volltext nicht online. |
Hamel, P. (1992) Aerospace Vehicle Modelling Requirements for High Bandwidth Flight Control. In: Proceedings of the IMA Conference on Aerospace Vehicle Dynamics and Control, Cranfield, UK, 7 - 10 September 1992. IMA Conference on Aerospace Vehicle Dynamics and Control, Cranfield Institute of Technology, Cranfield, UK, 7 - 10 September 1992. Volltext nicht online. |
Hammesfahr, J. (1992) Nutzung der Satelliten-Navigationssysteme GPS und GLONASS fuer die zivile Luftfahrt. DGLR, Bonn, Germany. Vortrag, gehalten auf: Deutsche Luft- und Raumfahrt-Kongress 1992, Bremen, 29.09.-02.10.92 Proc.: DGLR Jahrbuch 1992 I, GW ISSN 0070-4083. Volltext nicht online. |
Hammesfahr, J. (1992) Nutzung der Satelliten-Navigationssysteme GPS und GLONASS fuer die zivile Luftfahrt. DGLR, Bonn, Germany. Vortrag, gehalten auf: Deutscher Luft- und Raumfahrtkongress 1992, Bremen, 29.9.-2.10.92; Proc.: DGLR Jahrbuch 1992 I, GW ISSN 0070-4083. Volltext nicht online. |
Hammesfahr, J. (1992) Nutzung der Satelliten-Navigationssysteme GPS und GLONASS fuer die zivile Luftfahrt. Wissenschaftliches Kolloquium, DLR, NE-HF, Oberpfaffenhofen, 30.7.92.. Volltext nicht online. |
Hanke, D. (1992) Anforderungen an Flugeigenschaften. CCG-Lehrgang LR 4.05 "Moderne Unterstuetzungssysteme fuer den Piloten", Braunschweig, 21.-25.09.1992. Volltext nicht online. |
Hanke, D. (1992) Flugeigenschaftskriterien fuer reglerunterstuetzte Flugzeuge. CCG-Lehrgang LR 4.05 "Moderne Unterstuetzungssysteme fuer den Piloten", Braunschweig, 21.-25.09.1992. Volltext nicht online. |
Hanke, D. (1992) ATTAS - DLR's Flying Testbed for Aeronautical Research. Lecture Series at the National Aeronautical Laboratory (NAL), Bangalore, India, 30 November - 08 December 1992. Volltext nicht online. |
Hanke, D. (1992) ATTAS-IFS System Design and Capabilities. Part I - III. Lecture Series at the National Aeronautical Laboratory (NAL), Bangalore, India, 30 November - 08 December 1992. Volltext nicht online. |
Hanke, D. (1992) In-Flight Simulation. Fidelity Aspects. Lecture Series at the National Aeronautical Laboratory (NAL), Bangalore, India, 30 November - 08 December 1992. Volltext nicht online. |
Hanke, D. and Lange, H.-H. (1992) The Role of System Simulation for the Development and Operation of ATTAS. In: Proceedings of the Flight Simulation Conference, Moscow, Russia, 11 - 16 August 1992. Volltext nicht online. |
Hannemann, K. (1992) Gasdynamik - physikalische Phaenomene. Seminarvortrag Institut fuer Angewandte Mathematik, Uni Hannover, 12.02.1992. Volltext nicht online. |
Hannemann, K. (1992) Numerische Simulation von Einlauf-, Duesen- und Eckenstroemungen. SAENGER-Technologieprogramm - Aerothermodynamik, 2. Review Phase Ib, DASA, Muenchen, 26.-27.11.92. Volltext nicht online. |
Hannemann, K. (1992) Design of Hypersonic Nozzles and Calculation of Nozzle Flows. In: Forum Weltraumforschung RWTH Aachen, SPACE COURSE, Course Notes, Aachen 1991. Volltext nicht online. |
Hannemann, K. and Brenner, G. (1992) Numerical Simulation of Reacting Flows Related to the HEG. Euromech 296, Real Gas Effects in High Enthalpy Flows, , , 8.-10.09.1992, Goettingen. Volltext nicht online. |
Hannemann, K., Brenner, G., Prinz, U., (1992) Numerical Simulation of the Chemical Nonquilibrium Flow in a High-Enthalpy-Windtunnel. EUROMECH 289, Hypersonic Aerodynamics, RWTH Aachen, 6-8. April 1992. Volltext nicht online. |
Hansen, H. and Schrauf, G. and Rohardt, C.-H. (1992) Evaluation of the ELFIN F100-Glove Flight Test. In: DGLR. DGLR, Bonn. 8. DGLR-Fachsymposium Stroemungen mit Abloesung, Koeln-Porz, 10.-12.11.1992. Volltext nicht online. |
Hansen, J. (1992) Oekologische Modernisierung der Produktion: F+E-Foerderung durch das BMFT. Vortrag beim Deutschen Rat für Landespflege, Bonn, 19. Oktober 1992.. Volltext nicht online. |
Hansen, J. and Bellmann, U. (1992) R22-Einsatz im Bereich der Gewerbekaelte. Workshop beim Projektträger "Umweltschutztechnik", Bonn, 22. September 1992.. Volltext nicht online. |
Haschberger, Peter (1992) Fourierspektrometer mit rotierendem Retroreflektor. VI. Meßtechnisches Symposium des Arbeitskreises der Hochschullehrer für Meßtechnik, Dresden, Oktober 1992.. Volltext nicht online. |
Hasselmann, K.(1) and Sausen, R. (Vortragender) and Maier-Reimer, E.(1) and Voss, R.(2) (1992) On the Cold Start Problem of Coupled Atmosphere-Ocean Models. Second Intern. Conf. on Modelling of Global Change and Variability, Hamburg, 7.-11.9.92. Volltext nicht online. |
Hauber, E. and Neukum, G. (1992) Multispektrale Analyse der Valles Marineris Region, Mars. AEP-Frühjahrstagung, Berlin, 30.3.-2.4.1992. Volltext nicht online. |
Hauber, E. and Neukum, G. (1992) Multispektrale Analyse der Valles Marineris Region, Mars. AEP-Frühjahrstagung, Berlin, 30.3.-2.4.92. Volltext nicht online. |
Hauf, T. (1992) Beobachtungen zum Tagesgang konvektiv angeregter Schwerewellen. Deutsche Meteorologen-Tagung, Berlin, 16.-20.9.1992. Volltext nicht online. |
Hauf, T. (1992) First Results from the CLEOPATRA Field Experiment 1992. WMO Workshop on Cloud Microphysics and Applications to Global Change, Toronto, Canada, 9.-14.8.1992. Volltext nicht online. |
Hauf, T. (1992) Konvektion und Schwerewellen. ETH Zürich, Laboratorium für Atmosphärenphysik, 4.5.1992. Volltext nicht online. |
Hauf, T. and Höller, H. and Ehret, G. (1992) A Combined Observational Study of a Midlatitude Thunderstorm. 11th International Conference on Clouds and Precipitation, Montreal, Canada, 17.-21.8.1992. Volltext nicht online. |
Hausamann, Dieter (1992) Remote sensing of stratospheric OH from high altitude aircraft. In: Spectroscopy Seminar des Herzberg Institute of Astrophysics, Ottawa, Kanada, Dez. 1992. Volltext nicht online. |
Head, J.W.(1) and Murchie, S.L.(1) and Belton, M.J.S.(2) and Veverka, J.(3) and McEwen, A.(4) and Anger, C.D.(5) and Carr, M.H.(6) and Chapman, C.R.(7) and Davies, M.E.(8) and Greeley, R.(9) and Greenberg, R.(10) and Ingersoll, A.P.(11) and Johnson, T.V.(12) and Klaasen, K.P.(12) and Neukum, G. and Pieters, C.B.(1) (1992) Color Variations on the Surface of Gaspra. World Space Congress COSPAR, Washington, USA, 28.8.-5.9.92. Volltext nicht online. |
Heberle, N. and Heinze, J. and Kohse-Höinghaus, K. and Meier, U. (1992) Methyl Radical Detection by Resonance Ionization Spectroscopy in Filament-Assisted CVD. Gordon Research Conference on Diamond Synthesis by Chemical Vapor Deposition, Plymouth, New Hampshire, USA, June 1992.. Volltext nicht online. |
Heberle, N. and Heinze, J. and Meier, U. and Kohse-Höinghaus, K. (1992) Quantitativer Nachweis von CH3 mit REMPI. DLR-Kolloquium LIF 5, Lampoldshausen, 28. 01.1992.. Volltext nicht online. |
Heberle, N. and Heinze, J. and Meier, U. and Kohse-Höinghaus, K. and Schäfer, L. and Klages, C.-P. (1992) CH3 Radical Concentration Investigated by REMPI Spectroscopy in a Hot-Filament CVD Reactor. DIAMOND. Heidelberg, 1992.. Volltext nicht online. |
Hecker, P. and Doehler, H.-U. (1992) Modellgestuezte Luftbildanalyse zur Navigation. In: Workshop "Bordautonome Navigation", 20. Mai 1992, Neubiberg Uni der BW Muenchen, Fakultaet Fuer Luft- undRaunfahrttechnik. Volltext nicht online. |
Heddergott, A. and Wedemeyer, E. and Stanewsky, E. (1992) Pressure distribution measurements on a model with extreme span to width ratio in the DLR adaptive wall rubber tube test section. Vortrag: European Forum on wind tunnels and wind tunnel test techniques, Southampton, 14-17 Sept. 1992. Volltext nicht online. |
Heddergott, A. and Wedemeyer, E. and Stäger, W. and Haselmeyer, H. (1992) Windkanalmessungen an einem Propeller im Hochgeschwindigkeits-Windkanal und im Niedergeschwindigkeits-Windkanal der DLR Goettingen. DLR-Zentrumskolloquium, Göttingen, 27.08.1992. Volltext nicht online. |
Heel, F. (1992) Kalibrierung von Synthetik-Apertur-Radar-(SAR) Systemen. Wissenschaftliches Kolloquium der DLR, Oberpfaffenhofen, 5.10.1992. Volltext nicht online. |
Heel, F. and Oettl, H. and Seifert, Peter (1992) Synthetic Aperture Radar (SAR) Instrument Properties and In-Flight Antenna Pattern Measurement. Vortrag, gehalten auf: 18th Symp. on Space Technology and Science (ISTS), Kagoshima, Japan, 17.-22.5.92. Proc. of the 18th Symp. on Space Technology and Science (ISTS). Volltext nicht online. |
Heidenreich, B. (1992) Anwendung von Faserverbundwerkstoffen. Seminar "Faserverbundwerkstoffe", DLR-Stuttgart, 2./3.Nov.92, Veranst.: Deutsche Ges.Materialkunde (DGM), Oberursel/Taunus. Volltext nicht online. |
Heilmanm, R. (1) and Wandernoth, B. (1992) Active Thermal Frequency Stabilization of a Monolithic Integrated Twisted-Mode-Cavity Nd:YAG Laser. Poster at XVIII Intern. Quantum Electronics Conf. (IQEC'92) vom 14. - 19.6.1992 in Wien. Volltext nicht online. |
Heilmann, R. (1992) Frequenzstabile Laser für die optische Kommunikation und LIDAR. In: Tagungsband 3. Berliner Optiktage 1992. 3. Berliner Optiktage 29.9. - 1.10.92, Leibniz-Arbeitskreis, Berlin. Volltext nicht online. |
Heilmann, R. and Wandernoth, B. (1992) Active thermal frequency stabilisation of a monolithic integrated twisted-mode-cavity Nd: YAG laser. XVII International Conference on Quantum Electronics Technical Digest Series, Wien. Volltext nicht online. |
Heilmann, R., Wandernoth, B. (NE-NT), (1992) Frequenzstabilisierung von Nd: YAG-Lasern auf der Basis geregelter Lichtabsorption. 2. Workshop über Kohärent-optische Weltraumkommunikation, Enkrich/Mosel, 2.-6.10.92. Volltext nicht online. |
Heimann, D. (1992) Die Wechselwirkung von Foehn und Kaltfronten im noerdlichen Alpenvorland. In: Annalen der Meteorologie, 27, pp. 21-22. DWD Offenbach. Deutsche Meteorologen-Tagung 1992, Berlin, 16.-20.3.1992. Volltext nicht online. |
Heimbold, G. (1992) Phase C1 Configuration and User Access to the European Proximity Operations Simulator-EPOS. In: ESA-WPP-39 (1992). ESA-WPP-39, Noordwijk, 25-27 November 1992. Second ESA Workshop on Simulators for European Space Programmes1992. Volltext nicht online. |
Heller, H. (1992) Der Lärm propellergetriebener Flugzeuge der Allgemeinen Luftfahrt in Relation zu den geltenden internationalen Vorschriften. Lärmminderungsmaßnahmen der Allgemeinen Luftfahrt, Bonn, 10.11.1992. Volltext nicht online. |
Heller, H. (1992) Physikalisch Grundlagen der Lärmmessung. Informationsveranstaltung Fluglärmgesetz für die Luftfahrtreferenten der neuen Länder, Berlin, 11.03.1992-12.03.1992. Volltext nicht online. |
Heller, H. (1992) Helicopter Tail Rotor Aeroacoustics. Vortrag Nanjing Aeronautical Institute, Nanjing, 29.09.1992. Volltext nicht online. |
Hemmersbach-Krause, R. (1992) Paramecium. NiZeMi-Labormodell-Erfahrungsaustausch, DLR FF-ME, Köln, 23.06.92. Volltext nicht online. |
Hemmersbach-Krause, R. and Briegleb, W. (1992) Swimming Behavior of Paramecium Under Altered Gravity Conditions. World Space Congress, Washington, USA, 28.08.-05.09.92. Volltext nicht online. |
Hemmersbach-Krause, R. and Briegleb, W. and Häder, D.-P. and Vogel, K. (1992) Gravitaxis Analysis of Paramecium (Results of a Space Experiment on a Sounding Rocket). 7th European Conference on Ciliate Biology, Toledo, Spanien, 02.-07. 09.1991. Volltext nicht online. |
Hemmersbach-Krause, R. and Briegleb, W.Pharmateuti and Vogel, K. and Häder, D.-P. (1992) Rolle der Schwerkraft für das Verhalten von Paramecium. 11. Wissenschaftliche Tagung der DGP, Osnabrück, 19.-21.03.92. Volltext nicht online. |
Henckels, A. (1992) Heat Transfer Test Techniques Using IR-Thermography at H2K Cologne. DEA-Meeting "Windtunnels and Flight Simulation", TH Darmstadt, 22-23 April 1992. Volltext nicht online. |
Henckels, A. and Kreins, A. F. and Maurer, F. (1992) Development and Application on Infrared- and other Flow Visualization Techniques in a Hypersonic Wind-Tunnel of DLR Cologne. Royal Aeronautical Society; ISBN 1 857680502, London. European Forum on "Wind-Tunnels and Wind-Tunnel Test Techniques", Southampton, September 14-17 1992. Volltext nicht online. |
Henckels, A. and Kreins, A. F. and Maurer, F. (1992) Hypersonic Shock Wave Boundary Layer Interactions Including Separation and Reattachment Phenomena. EUROMECH 289, 06.-08. April 1992, RWTH Aachen. Volltext nicht online. |
Henckels, A. and Maurer, F. (1992) Hypersonic Corner Flow Detailed Experimental Study. In: Proceedings of the Workshop on Hypersonic Flows for Reentry Problems, Part II; Held in Antibes, France; 15-19 April 1991, pp. 441-454. Springer-Verlag Berlin-Heidelberg; ISBN 3-540-56189-7. Proceedings of the Workshop on Hypersonic Flows for Reentry Problems, Part II; Held in Antibes, France; 15-19 April 1991. Volltext nicht online. |
Henne, R. and Kayser, A. and Borck, V. and Schiller, G. (1992) Production of Mo-doped Raney-Nickel Electrodes Applying Vacuum Plasma Spraying. In: Proc. Int. Thermal Spray Conf. (ITSC) 1992. Proc. Int. Thermal Spray Conf. (ITSC) '92, Orlando, FL, USA, 28th May - 5th June 1992. Volltext nicht online. |
Hennings, H. (1992) Untersuchungen des Schwingungsverhaltens einer Windkraftanlage auf der Basis gemessener Zeitreihen. Deutsche Windenergie-Konferenz 1992 "DEWEK '92", 28.-29.10.1992, Fachhochschule Wilhelmshaven.. Volltext nicht online. |
Herlach, D.M. (1992) Non-Equilibrium Solidification of Undercooled Metallic Melts (invited). IIIrd International Conference on Amorphous Metallic Materials Bratislava, 7.-11.9.1992. Volltext nicht online. |
Herlach, D.M. (1992) Nonequilibrium Solidification of Undercooled Metallic Melts (invited). 1st Pacific RIM International Conference on Advanced Materials and Processing, 1992-06-23 - 1992-06-27, Hangzhou, VRC. Volltext nicht online. |
Herlach, D.M. (1992) Nonequilibrium solidification of deeply undercooled metallic melts (invited). Universita di Padova, Italien, 15. October 1992. Volltext nicht online. |
Herlach, D.M. (1992) Unterkuehlte Metallschmelzen:Phasenselektion und Kristallwachstum (invited). Technische Universitaet Braunschweig, 23. Oktober 1992. Volltext nicht online. |
Herlach, D.M. and Barth, M. and Eckler, K. and Volkmann, T. (1992) Strukturbildung aus dem schmelzfluessigen Zustand. Oberseminar Ruhr-Universitaet Bochum, 18.2.1992. Volltext nicht online. |
Herrmann, A.S. (1992) The world of composites. Besuch einer internationalen Fachjournalistengruppe bei der DLR, Koeln, 25.2. 1992.. Volltext nicht online. |
Herrmann, A.S. (1992) Kraftfluss durch Scheiben mit Ausschnitten. Carl-Cranz-Ges. CCG, Lehrgang BW 2.02, "Strukturmechanische Berechnung im Leichtbau mit Faserverbundwerkstoffen"' Braunschweig, 11.5.-15.5.1992. Volltext nicht online. |
Herrmann, A.S. (1992) Rechenprogramme zur Schichtentheorie. Carl-Cranz-Ges. CCG, Lehrgang BW 2.02, "Strukturmechanische Berechnung im Leichtbau mit Faserverbundwerkstoffen", Braunschweig, 11.5.-15.5.1992.. Volltext nicht online. |
Herrmann, A.S. (1992) Werkstoff- und Bauteilanalysen mit dem Programm Lam Tech. Gesellschaft Deutscher Chemiker/Demozentrum,BS, Fortbildungsk. 624/92 "Leichtbau mit Verbundwerkstoffen im Verkehrswesen", Braunschweig, 6.-7.10. 1992.. Volltext nicht online. |
Herzler, J. and Frank, P. (1992) Kinetics of Hydrogen Radical Attack on Phenylacetylene at High Temperatures. Twelfth International Symposium on Gas Kinetics, Reading, UK, 1992. Volltext nicht online. |
Herzler, J. and Frank, P. (1992) Investigation of the High Temperature Reaction of H-Atoms with Phenylacetylen. 24th International Symposium on Combustion, Sydney, Australia, 5-10 July 1992.. Volltext nicht online. |
Heutger, H. (1992) ATTAS Ground Based Simulation Facilities. Lecture Series at the National Aeronautical Laboratory (NAL), Bangalore, India, 30 November - 08 December 1992. Volltext nicht online. |
Heutger, H. (1992) Nonlinear Contributions to the In-Flight Simulation Technique. Lecture Series at the National Aeronautical Laboratory (NAL), Bangalore, India, 30 November - 08 December 1992. Volltext nicht online. |
Heutger, H. (1992) ATTAS Nonlinear In-Flight Simulation Applications and Flight Test Results. Lecture Series at the National Aeronautical Laboratory (NAL), Bangalore, India, 30 November - 08 December 1992. Volltext nicht online. |
Heyland, D. (1992) Requirements on a documentation management system derived from the E1 COLUMBUS Precursor Mission. In: Workshop Proceedings, Feb. 1992. Workshop, ESA/ESRIN, Frascati, 18.11.-20.11.1992. Volltext nicht online. |
Hiesinger, H. and Hoffmann, H. and Jaumann, R. and Rebhan, H. (1992) Mare Humorum. In: Verhandlungen DPG 27 (1992) VI, S. 1663.Geochemische und geologische Interpretation multispektraler Bilddaten, 27, 1663-. Deutsche Physikalische Gesellschaft. Volltext nicht online. |
Hiesinger, H. and Hoffmann, H. and Jaumann, R. and Rebhan, H. and Neukum, G. (1992) Earth-based multispectral observations of Mare Humorum and western Oceanus Procellarum. In: Geological and geochemical implications.. Lunar and Planetary Science Conference, Houston, 16.-20.03.92. Volltext nicht online. |
Hiesinger, H. and Hoffmann, H. and Jaumann, R. and Rebhan, H. and Neukum, G. (1992) Mare Humorum. In: Geochemische und geologische Interpretation multispektraler Bilddaten.. AEP-Konferenz, Berlin, 30.3.-2.4.92. Volltext nicht online. |
Hiesinger, H. and Hoffmann, H. and Jaumann, R. and Rebhan, H. and Neukum, G. (1992) Earth-based multispectral oberservations of Mare Humorum and Western Oceanus Procellarum. In: Lunar and Planetary Science Conference XXIII Abstract VolumeGeological and geochemical implications, pp. 533-534. Lunar and Planetary Institute, Houston, USA. Volltext nicht online. |
Hiesinger, H. and Neukum, G. (1992) Earth-based multispectral observations of Mare Humorum. DPS, München, 12.-16.10.1992. Volltext nicht online. |
Hilgenstock, A. (1992) Stroemungssimulation durch eine axiale Turbinenstufe. AG-Turbo Arbeitskreissitzung, DLR, Koeln Porz, 16.03.1992. Volltext nicht online. |
Hilgenstock, A. (1992) The Common Exercise II on the IEPG Delta-Wing Flow. IEPG-Workshop, Farnborough, UK, 10.-11.06.1992. Volltext nicht online. |
Hilgenstock, A. (1992) Dreidimensionale Stator-Rotorstroemung durch eine axiale Turbinenstufe. AG-TURBO Arbeitskreissitzung, DLR, Koeln-Porz, 16.-17.03.1992. Volltext nicht online. |
Hilgenstock, A. (1992) Laminar and Turbulent Flow Simulation Around WI1-SLE. IEPG-Workshop, NLR, Amsterdam, 19.02.1992. Volltext nicht online. |
Hillger, Wolfgang (1992) Verbesserung der Aussagefaehigkeit bei der Ultraschallpruefung von CFK-Laminaten durch Optimierung des Frequenzspektrums. Deutsche Gesellschaft fuer Zerstoerungsfreie Pruefung e.V. und Technische Hochschule Zwickau. 2. Kolloquium "Qualitaetssicherung durch Werkstoffpruefung", Technische Hochschule, Zwickau, 23.+ 24.9. 1992.. Volltext nicht online. |
Hillger, Wolfgang (1992) Zerstoerungsfreie Qualitaetskontrolle von mineralischen Baustoffen mit Hilfe der Ultraschall-Prueftechnik. Haus der Technik, e.V. Technische Hochschule Aachen, 10.11. 1992.. Volltext nicht online. |
Hillger, Wolfgang and Hass, R.* (1992) Ein neues Ultraschall-Inspektionssystem fuer den stationaeren und mobilen Einsatz. In: DGZfP "Innovative ZFP - eine Herausforderung fuer die gesamte Industrie", Bd. 33, Teil 2, 1992., 33, Teil 2, pp. 535-542. Vortraege und Plakatberichte DGZfP-Jahrestagung 1992 , Zerstoerungsfreie Materialpruefung, Fulda 27.-29.4. 1992.. Volltext nicht online. |
Hillger, Wolfgang and Heinrich, W.* (1992) Rechnergestuetzte manuelle Ultraschallpruefungen fuer die CFK-Instandsetzung. In: DGZfP "Innovative ZFP - eine Herausforderung fuer die gesamte Industrie" Bd. 33, Teil 1, 1992, 33,Teil 1, pp. 190-197. Vortraege und Plakatberichte DGZfP-Jahrestagung 1992, Zerstoerungsfreie Materialpruefung, Fulda 27.-29.4. 1992.. Volltext nicht online. |
Hinz, B. (1992) Einfuehrung in die Technologie der Faserverbundwerkstoffe. "Bauteile aus Faserverbundwerkstoffen"-Herstellung/Prüfung/ Zulassung/Öberwachung; DLR-Stuttgart / TÖV-Südwest: Filderstadt , 8.10.92. Volltext nicht online. |
Hinz, B. (1992) a) Vorstellung des Demo-Zentrums fuer FVW und des DLR-Instituts fuer Bauweisen-und Konstruktionsforschung, b) Bauteilgestaltung und Auslegung von FVW-Bauteilen, c) Krafteinleitung in FVW-Bauteile d) Fertigungsverfahren fuer faserverstaerkte Duromere. Seminar "Faserverbundwerkstoffe", DLR-Stuttgart, 2./3.Nov.92; Veranst.: Deutsche Ges. Materialkunde (DGM), Oberursel/Taunus. Volltext nicht online. |
Hirsch, H. and Arnold, G. and Lorenz, E. (1992) Fourier Transform Spectroscopy in Remote Sensing of Solid Planetary Surfaces. In: Proc. Spektroskopietagung, Linz, Juni 1992 (1992). Volltext nicht online. |
Hirsch, Ch. (1), Periaux, J. (2), Kordulla, W., (1992) Computational Fluid Dynamics '92. In: Proc. of the First European Conference, Bruessel, Belgium, 7.-11.09.1992, 2Baende. Elsevier, Amsterdam. Volltext nicht online. |
Hirzinger, G. (1992) A sensor-based telerobotic system for the space robot experiment ROTEX. Workshop Force Display in Virtual Environments and its Application to Robotic Teleoperation, IEEE Int. Conf., May 12-14, 1992. Volltext nicht online. |
Hirzinger, G. (1992) The space robot technology experiment ROTEX on spacelab-mission D2. In: Proc. Satellite Symposium 4: Columbus Eight (COSY-8) Utilisation of Earth Orbiting Laboratories, pp. 301-309. Internat. Space Year Conference, Munich, 30.3.-4.4.1992. Volltext nicht online. |
Hirzinger, G. and Dietrich, J. and Gombert, B. and Heindl, J. and Landzettel, K. and Schott, J. (1992) The sensory and telerobotic aspects of the space robot technology experiment ROTEX. In: Proc. i-SAIRAS'92. Int. Symposium `Artificial Intelligence, Robotics and Automation in Space, Sept. 30 - Oct. 2, 1992, Toulouse Labege, France. Volltext nicht online. |
Hirzinger, G. and Heindl, J. and Landzettel, K. and Brunner, B. (1992) Multisensory shared autonomy - a key issue in the space robot technology experiment ROTEX. In: Proc. IEEE Conf.. IEEE Conf. on Intelligent Robots and Systems, IROS'92, Raleigh, North Carolina, July 7-10, 1992. Volltext nicht online. |
Hirzinger, G. and Landzettel, K. (1992) The space robot technology experiment ROTEX on spacelab-D2. In: Proc. AIAA Conf.. AIAA Space Programs and Technology Conference, Huntsville, Alabama, March 24-27, 1992. Volltext nicht online. |
Hodiamont, S. and Peters, M. and Bunk, W. (1992) Pulverization of Al6Fe Melt-Spun Ribbons. In: Microstructure and Mechanical Properties, 2nd European Conf. on Advanced Materials and Processes, Vol. 1, pp. 35-42. The Institute of Materials, London, 1992. Volltext nicht online. |
Hoeher, P. (1992) TCM on Frequency-Selective Land-Mobile Fading Channels. In: Proc. of the 5th Tirrenia Intern. Workshop on Digital Comm., "Coded Modulation and Bandwidth-Efficient Transmission", pp. 317-328. Volltext nicht online. |
Hoeher, P. and Offer, E. (1992) Das Radio wird digital. - Neue Uebertragungsvefahren fuer den UKW-Stereo-Rundfunk. Wiss. Kolloquium am 14.12.92 in OP. Volltext nicht online. |
Hoffmann, H.-E. (1992) Analyse von Vereisungsfluegen mit luftfahrzeugbezogenem Vereisungsgrad severe. FA Flugmeteorologie, Gemeinsame Fortbildungstagung für Flugzeugführer und Wetterberater, Frankfurt/Main, Juli 1991. Volltext nicht online. |
Hoffmann, H.-E. (1992) The Analysis of Three Icing Flights with Various Accretion Structures when Reaching Icing Degree Severe. In: Mitteilungen, Beiheft 1/92, FA Flugmeteorologie der DMG Fortb.veranst.f.Flugzeugführer u. Wetterberater, Frankfurt, 13.4.91, pp. 3-10. Volltext nicht online. |
Hoffmann, H.E. (1992) Some Aspects of an Icing Atmosphere. SAE Subcommittee, Ac-9c, Working Group AircraftIcing Technology, Orlando, Florida, USA, Oct. 91. Volltext nicht online. |
Hoheisel, H. and Bütefisch, K.-A. and Lehmann, B. and Henke, R. and Roscher, H.J. Seelhorst, U., (1992) "THE JET BEHAVIOUR OF AN HIGH-BYPASS ENGINE AS DETERMINED BY LDA-MEASUREMENTS IN GROUND TESTS". AGARD Conference Proceedings 498 Aerodynamic Engine/Airframe Integration for High Performance Aircraft and Missiles Fluid Dynamics Panel Symposium held in Fort Worth, Texas, US 7th - 10th October, 1991. Volltext nicht online. |
Holland, R. and Müller, H. (1992) Data Acquisition for Investigations of Rotor Dynamics. In: Proceedings of the European Telemetry Conference ETC 92, Garmisch-Partenkirchen, 12 - 14 May 1992, pp. 455-465. Volltext nicht online. |
Holland-Moritz, D. and Herlach, D.M. and Urban, K. (1992) Undercooling and quasicrystal formation in Al-Cu-Fe and Al-Ni-Co alloys. 8th Internat.Conference on Liquid and Amorphous Metals, 1992, Wien. Volltext nicht online. |
Holste, F. and Neise, W. (1992) Experimentelle Analyse von akustischen Azimutalmoden in der Austrittsebene des Propfan-Modells CRISP zur Bestimmung der aerodynamischen Lärmquellen. In: Fortschritte der Akustik - DAGA 1992, Berlin, pp. 965-968. DAGA 92, Berlin , 31.3.-2.4.1992. Volltext nicht online. |
Holste, F. and Neise, W. (1992) Experimental determination of the main noise sources in a propfan model by analysis of the acoustic spinning modes in the exit plane. DGLR - Bericht 92-03. DGLR/AIAA 14th Aeroacoustics Conference 11-14.5.92 Aachen;. Volltext nicht online. |
Horn, R. (1992) E-SAR System Design for Polarimetric Measurements in X-band. In: Proc. Conf. URSI - Microwave Signatures '92, pp. IC-17-IC-22.. URSI Microwave Signatures '92, 1.-3.7.92, Igls, Innsbruck, Austria.. Volltext nicht online. |
Horn, R. and Moreira, J. (Vortragender) and Meier, E. *) (1992) A Refined Procedure to Generate Calibrated Imagery from Airborne Synthetic Aperture Radar. IEEE, Piscataway, N.J.. Vortrag, gehalten auf: IGARSS '92, Houston, Texas, 26.-29.5.92. Proc.: IEEE Cat.Nr. 92 CH 3041-1, Vol. I. Volltext nicht online. |
Hornbostel, A. (1992) Statistical and Event Based Analysis of 20-GHz Attenuation. ESA-ESTEC. Vortrag: OPEX XVIII-Meeting, Rom, Italy, 27.-29.10.92 Proc. of the 18th Meeting of Olympus Propagation Experimenters.. Volltext nicht online. |
Hornbostel, A. (Vortragender) and Schroth, A. (1992) Propagation Research on the 20 GHz Earth-Olympus Satellite Path. Vortrag, gehalten auf: URSI Microwave Signatures '92, 1-3 July 92, Igls-Innsbruck, Austria; Proc. Conf. URSI - MicrowaveSignatures '92. Volltext nicht online. |
Hornbostel, A. (Vortragender), Schroth, A., (1992) Monthly Statistics of 20 GHz Olympus Beacon Attenuation, Sky Noise and Meteorological Parameters. Vortrag, gehalten auf: 17th Meeting of Olympus Propagation Experimenters, OPEX XVII, Stockholm/Helsinki, 3.-5.5.92 Proc. of the 17th Meeting of Olympus Prop. Experimenters OPEX XVII. Volltext nicht online. |
Horneck, G. (1992) Life in and from Space. European International Space Year Conference " Space in the Service of Changing Earth", München, 30.03.-04.04.92. Volltext nicht online. |
Horstmann, K. H. and Miley, S. J. (1992) Comparison of Flight an Wind Tunnel Investigations of Tolmien-Schlichting-Waves on an Aircraft Wing. In: DGLR/AAAF/RAeS Proceedings First European Forum on Laminar Flow Technology, pp. 45-51. DGLR, Bonn. Volltext nicht online. |
Horstmann, K. H. and Mueller, R. and Wohlrath, W. and Dick, P. (1992) Flugversuche mit einem Laminarhandschuh an der DO 228. In: DGLR. DGLR, Bonn. 8. DGLR-Fach-Symposium Stroemungen mit Abloesung, Koeln-Porz, 10.-12.11.1992. Volltext nicht online. |
Horstmann, K. H. and Rohardt, C.-H. and Dressler, U, and Hansen, H. and Rill, S. (1992) Auslegung eines Laminarhandschuhs fuer die Fokker 100. In: DGLR. DGLR, Bonn. 8. DGLR-Fach-Symposium Stroemungen mit Abloesung, Koeln-Porz, 10.-12.11.1992. Volltext nicht online. |
Hounam, D. (1992) Die Abteilung fuer Mikrowellen-Technologie. Wissenschaftlicher Kolloquiumsvortrag, DLR, Oberpfaffenhofen, 30.9.92. Volltext nicht online. |
Hounam, D. (1992) Motion Errors and Compensation Possibilities. In: Proc. AGARD-LS-182. AGARD Lecture Series 182 'Fundamentals and Special Problems of Synthetic Aperture Radar (SAR)', Bad Neuenahr, 5.-6.10.92, Germany; Gebze-Kocaeli,8.-9.10.92, Turkey; Ottawa, 26.-27.10.92, Canada. Volltext nicht online. |
Hounam, D. (1992) SAR Simulation. Vortrag, gehalten auf: AGARD Lecture Series 182 'Fundamentals and Special Problems of Synthetic Aperture Radar (SAR)', Bad Neuenahr, 5.-6.10.92; Gebze-Kocaeli, 8.-9.10.92, Turkey; Ottawa, 26.-27.10.92, Canada. Proc. AGARD-LS-182. Volltext nicht online. |
Hounam, D.: Nowak, M. (Vortragender), (1992) The Detection of Deterministic Scatterers in SAR Images. DLR. Vortrag, gehalten auf: Microwave Signature '92, URSI, Igls-Innsbruck, Austria, 1./3.7.92. Proc.: Microwave Signatures '92. Volltext nicht online. |
Huber, P. (1) and Galleithner, H. (1992) Control Laws/Flying Qualities and Flight Test Results. In: NASA-CP-3137, Vol. 1, pp. 171-188. NASA High-Angle-of-Attack Projects and Technology Conference, Dryden Flight Research Facility, Edwards, CA, USA, 21 - 23 April 1992. Volltext nicht online. |
Huber, P. (1) and Galleithner, H. (1992) X-31A High Angle of Attack and Initial Post Stall Flight Testing. In: AGARD-CP-519. AGARD FMP Symposium "Flight Testing", Chania, Crete, Greece, 11 - 14 May 1992. Volltext nicht online. |
Huber, R. (1992) Systemanalytischer Vergleich von Thermalschutzsystemen. Vortrag der DGLR-Jahrestagung in Bremen, Veröffentlicht DGLR-Jahrbuch 1992. Volltext nicht online. |
Huebner, K. (1992) Laseroptische simultane L2F-Partikelgrößen- und Geschwindigkeitsmessung. DLR-SM-AT-Seminar, July 1992. Volltext nicht online. |
Hug, W. and Bussmann, H. and Brinner, A. (1992) Intermittent Operation and Operation Modelling of an Alkaline Electrolyzer. In: Proc., Vol. 2, pp. 783-791. Proc. 9th WHEC, Paris, 22nd - 25th June 1992. Volltext nicht online. |
Härtel , C. and Kleiser, L. (1992) Comparative Testing of Subgrid-Scale Models for Wall-Bounded Turbulent Flows. In: Computational Fluid Dynamics 192, Vol. 1, Ed. Ch. Hirsh et al., pp. 215-222. Elsevier - Amsterdam. Volltext nicht online. |
Hülsmann, S. and Bunk, W. (1992) Metall-Keramik-Verbunde mit gradiertem Gefuege pulvertechnisch hergestellt. In: Hauptversammlung der DGM, 1992, 9.-12. Juni, Hamburg (Kurzfassungen), 264-. DGM, Oberursel. Volltext nicht online. |
Hülsmann, S. and Schneider, H. (1992) Pulvertechnologische Herstellung von gradierten Metall-Keramik Verbindungen. In: DKG-Jahrestagung, 4.-7. Oktober 1992, Bayreuth, 322-. Deutsche Keramische Gesellschaft, Köln. Volltext nicht online. |
Hüners, H. (1992) Vergleich zwischen gemessenen und berechneten modalen Parametern und Verbesserung von Finite-Elemente-Modellen mit Hilfe der Messergebnisse. Seminar DR 1.01 der Carl-Cranz-Gesellschaft: "Experimentelle Modalanalyse - Ein modernes Hilfsmittel zur Loesung strukturdynamischer Probleme", Goettingen, 18.-21.05.1992.. Volltext nicht online. |
Hüners, H. (1992) Strukturelle Nichtlinearitaeten. Seminar DR 1.01 der Carl-Cranz-Gesellschaft: "Experimentelle Modalanalyse - Ein modernes Hilfsmittel zur Loesung strukturdynamischer Probleme", Goettingen, 18.-21.05.1992.. Volltext nicht online. |
Hüners, H. (1992) Neuere Entwicklungen auf dem Gebiet der strukturdynamischen Verifikation von Raumflugkoerpern. 4. Raumfahrt-Kolloquium an der Fachhochscule Aachen am 28.11.91 "Umgebungssimulation von Raumflugkoerpern, DGLR-Bericht 92-01.. Volltext nicht online. |
I
Ivanova, Krassimira and Schaefer, M. and Drummer, C. and Gerzer, R. (1992) Effects of nitric oxide-releasing agents on intracellular calcium concentrations and aggregation in washed human platelets. 2nd International Symposium on Endothelium-Derived Vasoactive Factors, Basel Switzerland, Basel, Switzerland. Volltext nicht online. |
Ivanova, Krassimira and Schaefer, M. and Gerzer, R. (1992) Modulation of agonist-induced increases in cytosolic ionized calcium and on platelet aggregation by nitric oxide-containing compounds. 8th International Conference on Second Messengers and Phosphoproteins, Glasgow, U.K., Glasgow, U.K.. Volltext nicht online. |
J
Jahn, A. (1992) Netzanalyse und Dimensionierung von Kommunikationsnetzen ueber LEO-Satelliten. Fernuniversitaet Hagen, Lehrgebiet Nachrichtentechnik, Hagen, 24.7.1992. Volltext nicht online. |
Jahn, A. (1992) Zur Beurteilung von landmobilen Satellitennetzen. Fernuniversitaet Hagen, Lehrgebiet Nachrichtentechnik, Hagen, am 24.7.1992. Volltext nicht online. |
Jahn, A. (1992) Vielfachzugriffsverfahren in Kommunikationssystemen. Fernuniversitaet Hagen, Lehrgebiet Nachrichtentechnik, Hagen, am 25.7.92. Volltext nicht online. |
Jahn, H. and Reulke, R. (1992) Bilddatenrestaurierung mit Subpixelgenauigkeit. In: Proceedings (1992) S. 515-520, 2, pp. 515-520. TH Ilmenau. 37. Int. Wiss. Kolloquium, TH Ilmenau 1992.. Volltext nicht online. |
Jakowski, N. and Bettac, H.-D. and Jungstand, A. (1992) Ionospheric Corrections for navigational and geodetic purpose. European Telemetry Conference, ETC '92 Garmisch-Partenkirchen, 12.05.- 14.05.1992. Volltext nicht online. |
Jakowski, N. and Jungstand, A. and Schlegel, K. and Kohl, H. and Rinnert, K. (1992) About the penetration of electric fields from high to low Latitudes during the ouset phase of geomagnetic storms. XVII. Generalversammlung der Europäischen Geophyskalischen Gesellschaft (EGS) in Edingburgh/UK vom 06. - 10.04.1992. Volltext nicht online. |
Jaschinski, A. and Kortüm, W. and Rentrop, P. (1992) Multibody Dynamics Software and Numerical Simulation of High-Speed Vehicles. In: CSME-Transactions. Forum SCGM 1992 "Transport 1992", 1.-5.6.92, Montreal Canada. Volltext nicht online. |
Jategaonkar, R. V. (1992) Identification of Aerodynamic Effectiveness and Interference Effects of Direct-Lift-Control Flaps from Flight Data. In: AIAA Paper 92-0171. 30th AIAA Aerospace Sciences Meeting and Exhibit, Reno, Nevada, USA, 6 - 9 January 1992. Volltext nicht online. |
Jaumann, R. and Gröbner, C. and Dummel, A. and Rebhan, H. and Neukum, G. (1992) Dependence of color ratios on the observation geometry. In: Lunar and Planetary Science Conference XXIII Abstract Volume, pp. 605-606. Lunar and Planetary Institute, Houston, USA. Volltext nicht online. |
Jaumann, R. and Gröbner, C. and Oehler, A. (1992) Color-dependent variations of the photometric phase function. In: Bull. Am. Ast. Soc. Vol. 24 (1992) 3Implications on the interpretation of multispectral data., 3. Am. Ast. Soc.. Volltext nicht online. |
Johnson, A. (1992) Design Procedures for Composite Cell Structures. In: Proc. 4 th Int. Conf. on Reinforced Materials and Composite Technologies. Verbundwerk 92; Wiesbaden, July 1-3,1992. Volltext nicht online. |
Johnson, A. (1992) Vordimensionierung von Strukturelementen aus FVW. Seminar Faserverbundwerkstoffe-Berechnung; DLR-Stuttgart 3./4. Nov. 1992 Veranst. Deutsche Ges. Maerialtechnik (DGM), Oberursel/Taunus. Volltext nicht online. |
Johnson, A.F. and Hinz, B. (1992) Development Study for a CFRP Transmission Housing. In: "Developments in the Science and Technology of Composite Materials" (Ed. Bunsell,A.R. et al ) Bordeaux: EACM 1992, pp. 933-939. Fifth Europ.Conf.on Composite Materials - ECCM 5 Bordeaux / F., April 7-10, 1992. Volltext nicht online. |
Johnson, A.F. and Hinz, B. (1992) Design and Fabrication of a Composite Transmission Housing for a Helicopter Tail Rotor. In: ICAS-Proc. Vol 2, Paper 92-6.7R1, pp. 1497-1504. 18 th Congr. Int. Council Aeronautical Sc.( ICAS ) Beijing / P.R.China, Sept. 20-25, 1992. Volltext nicht online. |
Joos, H.-D. and Gramlich, G. and Finsterwalder, R. and Lewald S., (1992) A Coherent Technology for Optimization-Based Control System Design. In: AnDeCS Minisymposium at 9th IFAC Workshop Control Applications of Optimization. Folien. Muenchen, 2-4 Sept. 1992. Volltext nicht online. |
Just, Dieter and Schättler, Birgit (1992) Doppler-Characteristics of the ERS-1 Yaw Steering Mode. In: IGARSS'92, Houston, USA, May 25-29, 1992. IEEE, New York, USA. Volltext nicht online. |
Just, Th. (1992) Reactions of Phenyl with Acetylene and O2. Seminar an den Exxon Research Laboratories, Linden, N.J., USA, Dezember 1992. Volltext nicht online. |
Just, Th. (1992) Reactions of Toluene, Benzyl and Phenyl. CEC Workshop, Lyon, France, September 1992. Volltext nicht online. |
Just, Th. (1992) Reaktionen aromatischer Kohlenwasserstoffe bei hohen Temperaturen. Kolloquium der GDCH, Universität Wuppertal, Januar 1992. Volltext nicht online. |
Just, Th. (1992) Decay of Toluene and Benzyl. Seminar an der Catholic University of Washington, Washington, D.C., Oktober 1991. Volltext nicht online. |
Just, Th. (1992) Measurements of CH3 and H-Profiles in a CVD-Reactor. Seminar an der University of Berkeley, California, USA, 9. September 1991.. Volltext nicht online. |
Just, Th. (1992) Reactions of Toluene and Phenyl. Seminar am Sandia CRF, Livermore, California, USA, 4. September 1991.. Volltext nicht online. |
Just, Th. (1992) Research on Combustion Problems at DLR Stuttgart. Seminar an der Stanford University, California, USA, 16. April 1991.. Volltext nicht online. |
K
Kadel, S.D.(1) and Greeley, R.(2) and Neukum, G. and Wagner, R. (1992) Composition and evolution of volcanism in the Lunar Orientale basin as determined from analysis of Galileo-Solid-State Imaging system multispectral data. DPS, München, 12.-16.10.92. Volltext nicht online. |
Kaletka, J. (1992) Identifizierung linearer Hubschrauber-Modelle hoher Bandbreite. Kolloquium Projektbereich A, Sonderforschungsbereich 212, TU Braunschweig, 25.08.1992. Volltext nicht online. |
Kallergis, M. (1992) Bodenstandlauf-Versuche zur aktiven Minderung des Propellerlaerms. DAGA92, Fortschritte der Akustik; 30.03.-03.04.92, Berlin. Volltext nicht online. |
Kallergis, M. (1992) Experimental Results on Propeller Noise Attenuation Using an "Active Noise Control" Technique. DGLR/AIAA 14th Aeroacoustics Conference, 11.-14.Mai 1992, Aachen. Volltext nicht online. |
Kallergis, M. (1992) Propeller und Kolbenmotor-Auslass - ein aussichtsreiches Quellenpaar zur aktiven Minderung des Fluglaerms. Vortrag beim DGLR Fachausschuss T2.4 Stroemungsakustik/Fluglaerm, Braunschweig, 12. November 1992. Volltext nicht online. |
Kallergis, M. and Kallergis, K. (1992) Aktive Minderung des Lärms von Propellerflugzeugen mit Kolbenmotor-Antrieb. DGLR, Bonn. Jahrestagung 1992 der DGLR. Volltext nicht online. |
Kallergis, M. and Kallergis K., (1992) A Theoretical Model and the Experimental Verification of Active Noise Control Application on Light Propeller-Driven Aeroplanes. Swiss Acoustical Society, Duebendorf, Schweiz. 6th FASE-CONGRESS 1992, Zuerich, Schweiz, 29.7.-31.7.1992. Volltext nicht online. |
Kalt, A. and Groer, U. (1992) Entwurf des Sonnenofens SOF fuer die AG Solar NRW zur Durchfuehrung solarchemischer und materialtechnischer Untersuchungen. In: Tagungsbericht 8. Int. Sonnenforum 1992 (1992) 1358-1364., pp. 1358-1364. DSG-Sonnenenergie Verlags-GmbH, München. 8. Internationales Sonnenforum 1992 - Energie und unsere Umwelt-, Berlin, 30.06.-03.07.1992.. Volltext nicht online. |
Kameier, F. and Nawrot, T. and Neise, W. (1992) Experimental investigation of tip clearance noise in axial flow machines. DGLR - Bericht 92 -. DGLR - AIAA 14th Aeroacoustics Conference , 11-14.5.92 , Aachen. Volltext nicht online. |
Kausche, G, (1992) An Approach to a Blockage Correction Method for Open Test-Sections with a Ground Plane. 15th Meeting of SAE Sub-Committee "Open-Jet Wind-Tunnel Boundary Interference", Motor Industry Research Association (MIRA), Nuneaton (England), 05.05.92. Volltext nicht online. |
Keil, M. and Coenradi, B. and Rall, R. and Sima, M. (1992) The National Parks of Bavarian Forest and Sumava - A Landsat TM Perspective on the Structure an Dynamics of the Largest Woodland of Central Europe. European International Space Year Conference. Volltext nicht online. |
Keller, H.U. and Kührt, E. (1992) CO-driven Outbursts. In: Proc. Workshop "Activity of distant comets", Lenggries 1992 (1992).. Volltext nicht online. |
Keller, H.U. (1) et.al. (1992) COLUMBUS Protoplanetesimal Dust Aggregation Experiment, VIIIth European Symposium on Materials and Fluid Sciences in Microgravity, Brussels, 12.4.1992. Volltext nicht online. |
Keller, H.U. (1), et.al., (1992) Columbus Proto-Planetesimal Dust Aggregation Experiment,. In: VIIIth European Symposium on Materials and Fluid Sciences in Microgravity, Brussels, 12.-16.4.1992. Volltext nicht online. |
Kempe, G. (1992) Endlosfaserverstaerktes Polyetheretherketon ( PEEK ). Lehrgang " Hochtemperaturbeständige Kunststoffe " Tech. Akademie Esslingen, 17.-18. Febr. 1992. Volltext nicht online. |
Kempe, G. (1992) Fertigungsverfahren fuer faserverstaerkte Thermoplaste. Seminar " Faserverbundwerkstoffe", DLR-Stuttgart, 2./3.Nov.92; Veranst.: Deutsche Ges. Materialkunde (DGM), Oberursel/Taunus. Volltext nicht online. |
Kempe, G. and Krauss, H. (1992) Adhesion Bonding Techniques for Highly Loaded Parts of Continuous Carbon Fiber Reinforced Polyetheretherketone ( CF-PEEK / APC 2 ). In: ICAS-Proc. Vol.2 : Paper 92-5.9.1, pp. 1892-1900. 18 th Congr. Int. Council of the Aeronautical Sciences (ICAS) Beijing / P.R.China ; Sept. 20-25,1992. Volltext nicht online. |
Kempe, G. Korger-Roth, G., (1992) Fuegetechniken fuer CF-PEEK ohne Faser-/ Matrixschaedigungen. Bauweisen-Kolloquium, DLR-Stuttgart 10.Sept.92. Volltext nicht online. |
Kensche, Ch. (1992) Einfluss von Feuchtigkeit und Hagel auf die Ermuedung von GFK-Rotorblaettern. DEWEK '92- Deutsche Windenergiekonferenz; Wilhemshaven: Deutsches Windenergie-Institut, 28./29.Okt.1992. Volltext nicht online. |
Kensche, Ch. and Selinger, P.F. (1992) Twice a Life for Sailplane - Wolfgang and Ulrich Huetter. In: Technical Soaring (erscheint voraussichtlich 1992). XXII. OSTIV-Congr. August 1-9, 1991, Uvalde, TX, USA.. Volltext nicht online. |
Kensche, Ch.W. (1992) Analogien in Bauweisen-und Zulassungsfragen zwischen Leichtflugzeugfluegeln und Rotorblaettern von Windturbinen. Bauweisen-Kolloquium, DLR-Stuttgart, 10.9.92. Volltext nicht online. |
Kensche, Chr. (1992) Herstellung und Eigenschaften von Fasern und Matrices. Seminar "Faserverbundwerkstoffe",DLR-Stuttgart, 2./3.Nov.92 Veranst.: Deutsche Ges. Materialkunde (DGM), Oberursel/Taunus. Volltext nicht online. |
Kessler, R. (1992) Homogene Turbulenz: Definition und Eigenschaften, Nutzung fuer die Turbulenzmodellierung. Turbulenz, 5.-8. Okt. 1992, Uni Erlangen. Volltext nicht online. |
Kessler, R. (1992) Wandnahe Modellierung der Epsilon-Gleichung mit Hilfe von DNS-Daten. 8. DGLR-Fach-Symposium, Stroemungen mit Abloesung, 10.-12. Nov. 1992, DLR Koeln-Porz. Volltext nicht online. |
Kessler, R. (1992) Erscheinungsformen der Turbulenz und Auswirkungen auf Stroemungen, Reynoldssche Gleichungen. Turbulenz, 5.-8. Okt. 1992, Universitaet Erlangen. Volltext nicht online. |
Kessler, R. (1992) Direct Numerical Simulation and Modelling of Turbulence. Workshop 'Turbulence', 3.-4. Febr. 1992, Universitaet Tvente, Holland. Volltext nicht online. |
Keydel, W. (1992) Basic Principles of SAR. Vortrag, gehalten auf AGARD Lecture Series 182 'Fundamentals and Special Problems of Synthetic Aperture Radar (SAR)', Bad Neuenahr 5.-6.10.92; Gebze-Kocaeli, 8.-9.10.92, Tuerkei; Ottawa, 26.-27.10.92, Canada; Proc. AGARD-LS-182. Volltext nicht online. |
Keydel, W. (1992) SAR Pecularities, Ambiguities and Constraints. Vortrag, gehalten auf: AGARD Lecture Series 182 "Fundamentals and Special Problems of Synthetic Aperture Radar (SAR)", Bad Neuenahr, 5.-6.10.92, Germany; Gebye-Kocaeli, 8.-9.10.92, Tuerkei; Ottawa, 26.-27.10.92, Canada; Proc. AGARD-LS-182. Volltext nicht online. |
Kiemle, C. and Ehret, G. and Jochum, A.M. (1992) Water Vapor Sensing in and above the Boundary Layer with an Airborne DIAL System: Results from the EFEDA '91 Experiment. Specialty Meeting on Airborne Radars and Lidars Toulouse, Frankreich, 7.-10.7.1992. Volltext nicht online. |
Kiemle, C.(Vortragender) and Ehret, G. and Renger, W. (1992) Tropospheric Water Vapor Profiling Using an Airborne DIAL System: Results from the EFEDA '91 Experiment. In: Proc. Intern. Szmposium on Environmental Sensing EUROPTO Berlin. Intern. Symposium on Environmental Sensing EUROPTO Berlin, 22.-26.6.1992. Volltext nicht online. |
Kienle, R. and Jörg, A. and Kohse-Höinghaus, K. (1992) Rotationsenergietransfer in OH(A exp 2 Sigma exp +). DLR-Kolloquium LIF 4, Göttingen, 18.02.1991.. Volltext nicht online. |
Kienle, R. and Jörg, A. and Kohse-Höinghaus, K. (1992) Collisional Energy Transfer in OH: Investigations for Quantitative LIF Combustion Diagnosis. Vortrag am Department of Combustion Physics, Lund Institute of Technology, August 1992. Volltext nicht online. |
Kietzmann, H. (1992) The Scope of DLR's SAR Calibration Program. Vorgetragen, auf European 'International Space Year" Conference 1992, Munich, 30.3.-4.4.92 Proc. of the Central Symp. of the 'Internat. Space Year" Conf. ESA SP-341, July 92. Volltext nicht online. |
Kießling, F. (1992) Experimentelle Bestimmung modaler Parameter im Frequenzbereich. Seminar DR 1.01 der Carl-Cranz-Gesellschaft: "Experimentelle Modalanalyse - Ein modernes Hilfsmittel zur Loesung strukturdynamischer Probleme", Goettingen, 18.-21.05.1992.. Volltext nicht online. |
Kießling, F. and Rippl, M. (1992) Aeroelastic Applications of PERMAS. INTES GmbH Stuttgart. 4. Finite Elemente Konferenz und PERMAS Benutzertreffen, Strassburg, Frankreich, 29.-30. April 1992, "Finite Elements in Engineering Applications 1992".. Volltext nicht online. |
Kindervater, C.M. and Lützenburger, M. (1992) Composite Airframe Crash Resistance-Simulation and Verification Studies Using KRASH. 18 th Europ.Rotorcraft Forum, Avignon / F., Sept.15-18,1992. Volltext nicht online. |
Kindervater, C.M. (DLR) (1992) Recorders Report of Final Round-Table Discussion. In: AGARD- CP -530. 74th Meetg. AGARD Structures and Materials Panel, Patras/ Greece, 24th-29th May 1992. Volltext nicht online. |
Kindervater, Ch. (1992) Stossabsorbierende FVK-Leichtbaustrukturen. Bauweisen-Kolloquium, DLR-Stuttgart, 10.Sept.92. Volltext nicht online. |
Kindervater, Ch. (1992) Crashstrukturen in Faserverbundbauweise. Seminarvortrag am Institut für Verbundwerkstoffe GmbH Kaiserslautern, 5. Okt. 1992.. Volltext nicht online. |
Kindervater, Ch. (1992) Untersuchungen zur Crashsicherheit von Luftfahrzeugen. Seminar für Leichtbau 1992 München: Universität d. Bundswehr 16.Jan.92. Volltext nicht online. |
Kindervater, Ch. (1992) Die klassische Laminattheorie. Seminar Faserverbundwerkstoffe-Berechnung; DLR-Stuttgart 3./4.Nov.1992 Veranst.:Deutsche Ges. Materialtechnik (DGM),Oberursel/Taunus. Volltext nicht online. |
Kindervater, Ch. (1992) Faserbundwerkstoffe- Mikromechanik / Laminatberechnung / Krafteinleitung / Crash-Energieabsorption. Bosch-Kolleg; Stuttgart: Fa. Bosch, 9.Nov.1992. Volltext nicht online. |
Kindler, K. (1992) Thermal Reaction of Heat Protection Material in Thermodynamic Nonequilibrium Flow. EUROMECH 296: "Real gas effects in high enthalpy flows", 8.-10. Sept. 1992, Goettingen. Volltext nicht online. |
Kindler, K. and Gülhan, A. and Jörres, V. (1992) Experiments on the Catalytic Efficiency of Heat Protection Materials in the Arc Heated Wind-Tunnel (LBK) of the DLR. Kluwer Academic Publishers, 3300 AA Dordrecht, Holland. Advanced Research Workshop New Trends in Instrumentation for Hypersonic Research, April 27th - 1st May 1992, ONERA, Le Fauga-Mauzac, France. Volltext nicht online. |
Kirchhof, Werner and Beran, Dieter and Gaida, M. and Schroeder, Manfred and Thomas, I. and Wendling, Peter (1992) Requirements for Earth Observation in Tropical and Subtropical Zones from Low Inclination. In: 17th Congress of the International Society for Photogrammetry and Remote Sensing (ISPRS), Washington D.C., August 2-14, 1992. 17th Congress of the International Society for Photogrammetry and Remote Sensing (ISPRS), 1992-08-02 - 1992-08-14, Washington DC (USA). Volltext nicht online. |
Kirchhof, Werner and Beran, Dieter and Gaida, M. and Schroeder, Manfred and Thomas, J. and Wendling, Peter (1992) Requirement for Earth Observation in Tropical and Subtropical Zones from Low Inclination Orbit. In: ISPRS, XVIIth Congress, International Archives of Photogrammetry and Remote Sensing, pp. 14-20. ISPRS Symposium, Washington, Vol. XXIX-B1. Volltext nicht online. |
Klaiss, H., Staiss, F. (ZSW), Winter, C.J., (1992) Systems Comparison and Potential of Solar Thermal Installations to the Mediterranean Area. In: Proc. 6th Int. Symposium on Solar Thermal Concentrating Technologies Plataforma Solar de Almeria, Mojacar, Spanien, Oktober 1992. Volltext nicht online. |
Klaiß, H. and Staiß, F. (1) and Winter, C.-J. (1992) Systems Comparison and Potential of Solar Thermal Installations in the Mediterranean Area. In: Proc. International Conference on Applications of Solar and Renewable Energy (ASRE 92). International Conference on Applications of Solar and Renewable Energy (ASRE 92), Kairo, 19th - 22nd April 1992. Volltext nicht online. |
Klaiß, H. and Winter, C.-J. (1992) Solarthermische Kraftwerke: Stand, Wirtschaftlichkeit, Marktpotential. In: Kurzfassung der Vorträge, pp. 181-183. Energietechnik 42. Jg. 5, XXIII. Kraftwerkstechn. Kolloquium, Dresden 26.-27. November 1992.. Volltext nicht online. |
Klaukien, M. and Hodiamont, S. and Staniek, G. and Peters, M. (1992) Ionenduennen von Al-Legierungspulvern und -baendern fuer die Durchstrahlungselektronenmikroskopie. In: Metallograhie, pp. 487-498. Carl Hanser, München/Wien. Volltext nicht online. |
Kleber, P. (1992) The Space Business: Setting the Scene. In: Proc. Space Commerce '92, Montreux (1992), pp. 3-8, pp. 3-8. Gordon & Breach Science Publishers. Space Commerce '92, Montreux. Volltext nicht online. |
Kleber, P. (1992) Competition or Cooperation, Subsidy and Technology Transfer in Space Business Development - A Personal View. In: Proc. Space Commerce '92, Montreux (1992) pp. 549-552, pp. 549-552. Gordon & Breach Science Publishers. Space Commerce '92, Montreux. Volltext nicht online. |
Kleber, P. and Stone, B. (1) (1992) The New Economic Frontier: Commercial Space. In: Proc. Symposium on Benefits from Space Activities, Beijing, 1992.. Symposium on Benefits from Space Activities, Beijing, October 1992.. Volltext nicht online. |
Kleber, P. and Stone, B. (1) (1992) Space: It's Not Just for Governments Anymore. In: Proc. Cocoa Beach Space Congress 1992, pp. 9-24-9-30.. Volltext nicht online. |
Kleber, P. and Stone, B. (1) (1992) Space Commerce in a Global Economy: Comparison of International Approaches to Commercial Development. In: Proc. IAF (1992); Paper IAA 92-0150 (1992) 8 p.. Volltext nicht online. |
Kleber, P. and Stone, B. (1) (1992) Following the Footprints of Smithy: From Rocketry Pioneers to Commercial Space Activities. In: The Sir Charles Kingsford Smith Memorial Lectures (1992) No. 34, 41 p., 56 refs.. Volltext nicht online. |
Klein, H. (1992) Technik der Beulversuche, Vorfuehrung eines Films, Vorfuehrung eines Beulversuchs. Carl-Cranz-Ges. CCG, Lehrgang BW 2.02, "Strukturmechanische Berechnung im Leichtbau mit Faserverbundwerkstoffe"' Braunschweig, 11.5.-.15.5.1992.. Volltext nicht online. |
Klein, H. and Schmitz, G,, and Woermann, D.* *Uni Koeln (1992) Spinodal Decomposition in Single Component Fluids. ESA Workshop "System with a Liquid Miscibility" Physik Zentrum, Bad Honnef, 1992. Volltext nicht online. |
Kleine-Tebbe, K. A. (1992) Simulation von Transportbeanspruchungen mit einer mehraxialen hydraulischen Pruefanlage. "Umwelteinfluesse erfassen, simulieren, bewerten", 21. Jahrestagung der Gesellschaft fuer Umweltsimulation (GUS), Pfinztal, 25.-27.03.92.. Volltext nicht online. |
Kleine-Tebbe, K. A. (1992) Comparison of Different Methods in Seismic Qualification of Electrical Equipment. 10th World Conference on Earthquake Engineering, July 19 - 24, 1992, Madrid, Spain.. Volltext nicht online. |
Kleintz, M. (1992) Mikrowellenabbildung mit synthetischer Apertur. Seminarvortrag an der Bergischen Universitaet/Gesamthochschule Wuppertal, Fachbereich Elektrotechnik, Wuppertal, 17.1.92.. Volltext nicht online. |
Klement, D. and Preissner, J. and Schwemmer, R., Stein, V. (Vortragender), (1992) Zur Bestimmung der Radarsignaturen von Sehrohren und Schiffen. Vortrag, gehalten auf: SIGMAR/RADAR Symposium, Eckernfoerde, 25.-27.2.92; Proc. SIGMAR NAS Signature Marine. Volltext nicht online. |
Klewe, H.-J. (1992) Telemetrie in Biomedizinischer Technik und Umweltforschung. Lehrgang "Telemetrie, Telecontrol" der Technischen Akademie Esslingen in Zusammenarbeit mit dem Arbeitskreis Telemetrie e.V. und dem DGLR-Fachausschuss 8.1 "Telemetrie", Ostfildern, 19.-21.02.1992. Volltext nicht online. |
Klewe, H.-J. (1992) Erfassen und Aufbereiten von Prozeßdaten. Lehrgang "Telemetrie, Telecontrol" der Technischen Akademie Esslingen in Zusammenarbeit mit dem Arbeitskreis Telemetrie e.V. und dem DGLR-Fachausschuß 8.1 "Telemetrie", Ostfildern, 19.-21.02.1992. Volltext nicht online. |
Klimov, S. and Sarin, S. and Nozdrachev, M. and Mogilevsky, M. and Petrukovich, A. and Romanov, S. and Skalsky, A. and Blecki, J. and Juchnevicz, J. and Büchner, J. Nikutovski, B., and Lehmann, H.-R. and Amata, E. and Woolliscroft, L. and Korepanpv, V. and Triska, P. and Vojta, J. and Hanasz, J. (1992) Role of the INTERBALL Small Scale Investigations in the GGS Programme. In: Proceedings of the 26th ESLAB Symposium, ESA SP-346 (1992). ESA Publ. Division, ESTEC, Noordwijk, The Netherlands. 26th ESLAB Symposium "Study of the Solar-Terrestrial System", Killarney, Ireland, 16-19 June 1992.. Volltext nicht online. |
Klingenberg, H.H. (1992) Mikrowellenangeregte Excimerlaser. Physikalisches Kolloquium der Universität Erlangen-Nürnberg am 7.5.1992. Volltext nicht online. |
Klingenberg, H.H. (1992) Nichtlineare Optik. SE 1.10 Hochenergielaser, CCG, Oberpfaffenhofen, 4.11.1992. Volltext nicht online. |
Klingenberg, H.H. (1992) Microwave Discharge Problems Investigated in an XeCl Gas Mixture. 103. WE-Heraeus-Seminar Gaseous and Electrode Phenomena in Diffuse High Current Density Discharges, Bad Honnef, 2.-5.11.1992. Volltext nicht online. |
Klingenberg, H.H. and Gekat, F. and Krutina, G. (1992) Mikrowellenangeregte Excimerlaser der mittleren Leistungsklasse. Verh. der DPG (Frühjahrstagung der Deutschen Physikalischen Gesellschaft) Vortrag Q 17.03, Hannover 1992. Volltext nicht online. |
Klingenberg, H.H. and Riede, W. (1992) Phasenkonjugierte Korrektur von Aberrationen bei 1 mikrometer Wellenlaenge. Laser-Seminar, Deutsch-Franz. Forschungsinstitut ISL, St.-Louis, Frankreich, 18.03.1992. Volltext nicht online. |
Klingenberg, H.H. and Riede, W. and Schelonka, L.P. (1992) Coherence Properties on the Four-Wave Mixing Efficiency in Solvents and Semiconductors. International Conference on Lasers 1992, Houston, Texas, Dec 7-10, 1992.. Volltext nicht online. |
Knoll, A.C. and Dooley, L.S. and Hetzheim, H. (1992) Pseudo-Boolean Matrix Techniques for State Minimisation of Finite State Machine Realisations of DSP Systems. Third IMA Conference on Mathematics in Signal Processing, University of Warwick, GB, 15-17 December 1992. Volltext nicht online. |
Koch, W. (1992) Direct Resonance of Secondary Instability Modes - A Possible Criterium for Transition Prediction. 1st European Fluid Mechanics Conference, Cambridge, 16-20 Sept. 1991, UK. Volltext nicht online. |
Kochan, H. (1992) Investigation of Martian Surface-near Phenomena in the DLR Space-Simulator. Mars-Simulation Workshop, 27.-29.1.1992, Bad Honnef. Volltext nicht online. |
Kochan, H. and Seidensticker, K. J. and Möhlmann, D. (1992) Gas-Dust Interaction Phenomena Observed at Cometary Analogous Ice/Dust Samples. COSPAR, Washington, August 1992. Volltext nicht online. |
Kochan, M. and Grün, E. and Lorenz, E. and Lämmerzahl, P. (1992) Land-Slides within Dust Mantle a New Process of Cometary Dust Emission. Second International Planetary Science Conference, 24th Meeting of the Division of Planetary Science of AAS, München, 12-16 October. Volltext nicht online. |
Kochan, H., et.al., (1992) Bistable Activity of a Cometary Analogous Ice-/Mineral Mixture during Insolation,. 23rd Lunar and Planetary Science Conference, 16.-20.3.1992, Houston. Volltext nicht online. |
Kochendörfer, R. (1992) Aus 33 Jahren Institutsarbeit. Bauweisen-Kolloquium, DLR-Stuttgart, 10.09.92. Volltext nicht online. |
Kochendörfer, R. (1992) Charakteristische Eigenschaften faserkeramischer Werkstoffe im Hinblick auf ihre Anwendungsmoeglichkeiten. Faserkeramikwerkstoffe- Eigenschaften und Anwendungen; Seminar Carl-Cranz-Ges., DLR-Stuttgart 24./25.11.92. Volltext nicht online. |
Kochendörfer, R. (1992) High Temperature Materials for Hypersonic Transport. In: Proc. Int. Symposium "Advanced Materials for Lightweight Structures", ESTEC, Noordwijk, NL, March 25-27, 1992 (ESA-SP-336, Oct. 1992), pp. 7-13. Int. Symp. "Advanced Materials for Lightweight Structures", ESTEC Noordwijk / NL, March 25-27, 1992. Volltext nicht online. |
Kochendörfer, R. (1992) Konstruktion mit Keramik. VDI-Verlag Düsseldorf, 1992. Seminar " Keramische Bauteile "; Berlin, 1./2.Okt.92, VDI-Bildungswerk ( Seminar Nr. 34-13-04 ).. Volltext nicht online. |
Koenigsdorff, R. (1992) Direktabsorption konzentrierter Solarstrahlung in Gas-Partikel-Gemischen. In: TagungsberichtAufbau einer Versuchsanlage und erste Ergebnisse., Vol. 2, pp. 1346-1351. 8. Internationales Sonnenforum, Berlin, 30.06.-03.07.1992. Volltext nicht online. |
Koepke, P. (1) and Thomas, Werner (Vortragender) and Roeckner, E. (2) (1992) The Impact of a Huge Solar Farm on Global Climate: A Case Study. Second Intern. Conf. on Modelling of Global Climate Change and Variability, Hamburg, 7.-11.9.1992. Volltext nicht online. |
Koerner, H. (1992) Laminarhaltung bei Verkehrsflugzeugen. Flugtechnisches Kolloquium, Institut fuer Luft- und Raumfahrttechnik, TU Berlin, 12. Juni 1992.. Volltext nicht online. |
Kohrs, R. (1992) Planung von 4D-Trajektorien an Bord eines Flugzeuges. Deutscher Luft- und Raumfahrtkongress, DGLR-Jahrestagung 1992, Bremen, 30.09.-02.10.92. Volltext nicht online. |
Kohse-Höinghaus, K. (1992) Laser-induzierte Fluoreszenz fuer den Nachweis von Atomen und Radikalen in Flammen und Reaktoren. Festkolloquium am Institut fuer Physikalische Chemie der Verbrennung, Stuttgart, Juni 1992. Volltext nicht online. |
Kohse-Höinghaus, K. (1992) Lasertechniken fuer die Untersuchung von Verbrennungsvorgaengen. Institutskolloquium am Institut fuer Raumfahrtsysteme der Universitaet Stuttgart, Juni 1992.. Volltext nicht online. |
Kohse-Höinghaus, K. (1992) Lasermessverfahren. DLR-Kolloquium LIF 4, Göttingen, 18.02.1991.. Volltext nicht online. |
Kohse-Höinghaus, K. (1992) Detection of Minority Species in Combustion and Diamond CVD Processes. Institutskolloquium Molecular Physics Laboratory, Katholieke Universiteit Nijmegen, Nederland, 25 August 1992.. Volltext nicht online. |
Kohse-Höinghaus, K. (1992) Entwicklung laserspektroskopischer Methoden fuer den quantitativen Nachweis von Atomen und Radikalen in reagierenden Stroemungen. Physikalisches Kolloquium, Universität Oldenburg, Dezember 1992. Volltext nicht online. |
Kohse-Höinghaus, K. (1992) Moderne Lasermesstechniken: Perspektiven fuer die In-situ-Diagnostik bei der motorischen Verbrennung. Kolloquium an der Fakultät Energietechnik, Universität Stuttgart, 1992.. Volltext nicht online. |
Kompenhans, J. and Raffel, M. and Höfer, H.-R. (1992) Instationäre Strömungsfeldmessungen an einem NACA 0012 Profil bei Ma = 0,75 mit Hilfe der Particle Image Velocimetry. Präsentation CP-ROT / Instationäre Rotoraeromechanik. Volltext nicht online. |
Kompenhans, J. and Raffel, M. and Vogt, A. (1992) Einsatz der Particle Image Velocimetry im Windkanal. Conference Proceedings/Workshop Lasermethoden in der Strömungsmechanik, 29. und 30. September 1992, Univ. Karlsruhe. Volltext nicht online. |
Koppenwallner, G., Sagnier, P., Eitelberg, G., Hannemann, K., (1992) Philosophy of High Enthalpy Wind Tunnel Utilization. In: CNES TA-Report No.: H-NT-0-2025 DLR, 1991 (HTG-Report 4-91, pp. 56-74. Volltext nicht online. |
Kordulla, W., Meier, G.E.A., Dallmann, U., (1992) Investigation of S&a.nger - Relevant Hypersonic and Boundary-Layer Transition Problems. In: Tagungsband, Review of GERMAN Hypersonic Research and Technology Programme, Bon, 16./17.04.1991, pp. 88-101. Volltext nicht online. |
Kordulla, W., Periaux, J., Alziary de Roquefort, T.,, (1992) Attempt to Evaluate the Computations for Test Case 6.1 - Cold Hypersonic Flow Past Ellipsoidal Shapes. In: Hypersonic Flows for Eentry Problems, pp. 689-712. Springer Verlag. Volltext nicht online. |
Kordulla, W., Radespiel, R., Krogmann, F., Maurer, F., (1992) Aerothermodynamics Activities in Hypersonics at DLR. AIAA, 4th International Aerospace Planes Conference, 1.-4. Dez. 1992, Orlando, Florida U S A. Volltext nicht online. |
Kordulla, W., Radespiel, R., Krogmann, P., Maurer, F., (1992) Aerothermodynamics Activities in Hypersonic at DLR. In: AIAA 4th International Aerospace Planes Conference, 1-4 Dec. 1992, Orlando, Florida USA, AIAA-Paper No. 92-5032. Volltext nicht online. |
Korn, I. (1992) Error Probability of Digital Modulation in Satellite Mobile, Land Mobile, and Gaussian Channels with Narrow-Band Receiver Filter. In: IEEE Trans. on Communications, April 1992, 40, Nr. 4, pp. 697-707. Volltext nicht online. |
Kortüm, W. (1992) Software zur Modellbildung und Simulation der Dynamik mechatronischer Systeme. In: Proc. CDI/VDE-GMA-Aussprachetag, 925, pp. 255-284. VDI. VDI/VDE-GMA-Aussprachetag 'Modellbildung fuer Regelung und Simulation - Methoden, Werkzeuge, Fallstudien - Langen, 25.-26.03.92. Volltext nicht online. |
Kortüm, W. (1992) Software zur Modellbildung und Simulation der Dynamik mechatronischer Systeme. In: Proc. VDI/VDE-GMA-Aussprachetag, Langen. VDI/VDE-GMA-Aussprachetag Modellbildung fuer Regelung und Simulation - Methoden, Werkzeuge, Fallstudien, Langen 25. und 26.03.92. Volltext nicht online. |
Kortüm, W. and Sharp, S. (1) (1992) The IAVSD Review of Multibody Computer Codes for Vehicle System Dynamics. In: Proc. third ASME Symposium on Transportation Systems. Third ASME Symposium on Transportation Systems, 1992 ASME Winter Annual Meeting, Anaheim, CA, USA, 09.-13.11.1992. Volltext nicht online. |
Kosmann, D. and Roth, A. and Schreier, G. (1992) Operational Geocoding of ERS-1 SAR Imagery. ISPRS Conference Commission II Washington. Volltext nicht online. |
Kosmann, D. and Roth, A. and Schreier, G. and Winter, R. (1992) The ERS-1 Radarmaps of Germany and the Antarctis peninsula. In: ISY Conference Munich, pp. 321-326. Volltext nicht online. |
Kosmann, D. and Roth, A. and Schreier, G. and Winter, R. (1992) The ERS-1 Radarmaps of Germany and the Antarctic Peninsula. ISY Conference, Munich. Volltext nicht online. |
Kost, F. (1992) Three Dimensional Transonic Flow Measurements in an Axial Turbine with Conical Walls. Paper for 37th ASME International Gas Turbine Congress. Volltext nicht online. |
Kost, F. (1992) A Study of Some Measurement Errors in L2F - Velocimetry. Proceedings of the 11th Symposium of "Measuring Techniques for Transonic and Supersonic Flow in Cascades and Turbomachines", Universitaet der Bundeswehr, Muenchen, September 1992. Volltext nicht online. |
Kraft, H. (1992) Pruefung an FVW-Bauteilen. "Bauteile aus Faserverbundwerkstoffen"-Herstellung / Prüfung Zulassung/ Öberwachung ; DLR-Stuttgart / TÖV-Südwest: Filderstadt 8.10.92. Volltext nicht online. |
Kraft, H. (1992) Kennwertermittlung und Pruefung von FVW. Seminar " Faserverbundwerkstoffe", DLR-Stuttgart, 2./3.Nov.92; Veranst.: Deutsche Ges. Materialkunde (DGM), Oberursel/Taunus. Volltext nicht online. |
Krain, H. (1992) High pressure ratio compressors. Short Course on Design of Radial and Mixed Flow Compressors, Cranfield Inst. of Technology, 2.-6.03.92, Cranfield, UK. Volltext nicht online. |
Krain, H. (1992) Kennfeldmessungen an einem Laufrad mit hohem Druckverhältnis. FVV-Arbeitskreissitzung "Radialverdichter hoher Schluckfähigkeit", 05.02.92, BMW-RR, Oberursel. Volltext nicht online. |
Krain, H. (1992) Test Case 2: Centrifugal Impeller. In: European Research Community on Flow Turbulence and Combustor (ERCOFTAC), Turbomachinery Special Interest Group. Seminar and Workshop on "3D Turbomaschinery Flow Prediction", 07.12.92, France. Volltext nicht online. |
Krain, H. (1992) Meßergebnisse mit dem SRV1-Rad. FVV-Arbeitskreissitzung "Radialverdichter hoher Schluckfähigkeit", 16.09.92 bei Sulzer-Escher-Wyss, Zürich, Schweiz. Volltext nicht online. |
Kramer, P.A. (1) and Krülle, G. (1992) Chemical Propulsion Research and Development in Germany. In: Proceedings 18th ISTS Conference, Kagoshima, Japan, May 1992.. Vortrag Nr. 4-x; 18th ISTS Conference; Kagoshima; Japan; Mai 1992. Volltext nicht online. |
Krause, O. (1992) Umweltschutz bei Transportunfaellen (Chemikalien) auf See, FE-Massnahmen des BMFT. Vortrag an der Versuchsanstalt für Wasserbau und Schiffbau, Berlin, 30. Januar 1992.. Volltext nicht online. |
Krause, S. (1992) Investigation of a New Heat-Pipe/Latent-Heat Storage Element for Solar Dynamic Power Systems. In: Proc. 27th IECEC 1992. 27th IECEC, San Diego, CA, USA, 3rd - 7th August 1992. Volltext nicht online. |
Kreins, A. F. (1992) Experimentelle Untersuchung zur Stoss-Grenzschicht-Wechselwirkung im Hyperschall unter Einsatz der IR-Thermographie. Vortrag für die Begutachtung des SFB 253, 10.02.1992, Aachen. Volltext nicht online. |
Kreins, A. F. and Henckels, A. and Maurer, F. (1992) Experimentelle Bestimmung der Waermeuebergangsverteilung in Bereichen laminar und turbulent abloesender Hyperschallgrenzschichten unter Einsatz der IR-Technik. 2. Kolloquium des SFB 253, Aachen, 01.10.1991. Volltext nicht online. |
Krenkel, W. (1992) Fluessigsilizierte faserkeramische Werkstoffe: Herstellung; Eigenschaften; Anwendungen. Bauweisen-Kolloquium, DLR-Stuttgart, 10.Sept.92. Volltext nicht online. |
Kreplin, H.-P. and Höhler, G. (1992) Application of the surface hof film technique to laminar flow investigations. In: First European Forum on Laminar Flow Technology, March 16-18, 1992 Hamburg, Vortrag. Nr. 92-01-017, Proceedings: DGLR-Bericht 92-06,, pp.123-131, pp. 123-131. DGLR, Bonn. Volltext nicht online. |
Krichbaumer, W. (1992) Airborne Cloud Measurements with the DLR-Microlidar during the CLEOPATRA Campaign. In: Vortrag. Speciality Meeting on airborne Radars and Lidars, Toulouse, France 7 - 10 July 1992. Volltext nicht online. |
Krichbaumer, W. (1992) Polarisation bei Lidarsignalen. Vortrag beim DFG-Workshop über "LIDAR zur Ableitung von Aerosol- u. Wolkeneigenschaften", 21.-22.10.92. Volltext nicht online. |
Kriebel, K.T. and Kästner, M. and Ruppersberg, G.H. and Renger, W. (1992) Validation of Satellite Derived Cirrus Cloud Optical Depth by Means of Calibrated ALEX Data. In: Report of the Earth Observation User Consultation Meeting (ELAC '90). ESTEC, Noordwijk, NL, 29-31 May 1991. Volltext nicht online. |
Kriebel, K.T. and Ruppersberg, G.H. and Renger, W. (1992) Validation of Satellite Derived Cirrus Cloud Optical Depth by Means of Calibrated ALEX Data. In: ESA report on ELAC '90. Volltext nicht online. |
Kroll, N. (1992) A Survey of Recent CFD Activities at DLR-Institute for Design Aerodynamics. Vortragsreihe: BUAA University, Peking und NPU, Xian, 07.10.1992-16.10.1992. Volltext nicht online. |
Kroll, N. (1992) Discretisation Properties in Hypersonic Flows. HERMES Research for Qualification, Bruessel, 21.10.1992-22.10.1992. Volltext nicht online. |
Kroll, N. and Blazek, J. and Radespiel, R. (1992) Improvement of Hypersonic Flow Solvers. HERMES Research for Qualification, Rom, 26.05.1992-27.05.1992. Volltext nicht online. |
Kroll, N. and Pahlke, K. (1992) Survey of CFD Activities in the DLR Institute for Design Aerodynamicsfor Helicopter Related Problems. Vortrag bei Westland Helicopters, Yeovil, UK, 06.04.1992-10.04.1992. Volltext nicht online. |
Krülle, G. and Labani, R. (1) and Mayer, W. (1992) Theoretical Investigations of Droplet Flow under Typical Coaxial Injector Flow Conditions in Cryogenic Rocket Engines. In: Proceedings AIAA 28th Joint Propulsion Conference. AIAA; 28th Joint Propulsion Conference; Nashville; TN; USA; 1992. Volltext nicht online. |
Krülle, G. and Mayer, W. (1992) Rocket Engine Coaxial Injector - Liquid/Gas Interface Flow Phenomena. In: Proceedings AIAA 28th Joint Propulsion Conference. AIAA; 28th Joint Propulsion Conference; Nashville; TN; USA; 1992. Volltext nicht online. |
Kube, R. and Achache, M. (1) and Niesl, G. (2) and Splettstößer, W. (1992) A Closed Loop Controller for BVI Impulsive Noise Reduction by Higher Harmonic Control. In: AHS Proceedings 1992, Vol. 2, pp. 819-842. 48th AHS Annual Forum and Technology Display, Washington, DC, USA, 3 - 5 June 1992. Volltext nicht online. |
Kuch, Wolfgang and Schulze, Mathias and Schnurnberger, Werner and Bolwin, Klaus (1992) Koadsorption von Wasser und Kalium auf Ni(111). In: DPG-Frühjahrstagung 1992. DPG-Frühjahrstagung 1992, Regensburg. Volltext nicht online. |
Kumpfert, J. and Grundhoff, K.-J. and Schurmann, H. and Lee, Y.T. and Ward, C.H. and Peters, M. (1992) Thermomechanical Treatment to Achieve Ultra-High Strength in Ti3Al-Based Titanium Aluminides. In: Proc. 2nd European Conference on Advanced Materials and Processes, Vol. 2, The Institute of Materials, London 1992, pp. 321-332. Volltext nicht online. |
Kumpfert, J. and Ward, C.H. and Lee, Y.T. and Peters, M. (1992) Improvement of Ductility and Strength of Super Alpha 2 by TMT. 7th World Conference on Titanium, San Diego, CA, USA, 1992. Volltext nicht online. |
Kutiev, I. and Stankov, S. M. (1992) Satellite data for use in the ionospheric mapping. In: Data validation of ionospheric models and maps. Proc. COST-238 PRIME/URSI Workshop, Roquetes, Spain, pp. 100-104.. Volltext nicht online. |
Kutiev, I. and Stankov, S. M. (1992) A global pattern of O<sup>+</sup>-H<sup>+</sup> transition level for use in IRI. COSPAR World Space Congress, [2002-08-28 - 2002-09-09], Washington, DC, USA. Volltext nicht online. |
Kutiev, I. and Stankov, S. M. (1992) Theoretical evidences of relative abundance of H<sup>+</sup> and He<sup>+</sup> ions applied to IRI. COSPAR World Congress, [1992-08-28 - 1992-09-09], Washington, DC, USA. Volltext nicht online. |
Kömle, N.I., (1) et.al., (1992) Effect of Non-Volatile Mantles on the Evolution of Cometary Surface Regions. XVII General Assembly, Edinburgh, 6.-10.4.1992. Volltext nicht online. |
König, R. (1992) Boeenlastminderung. CCG-Lehrgang LR 4.05 "Moderne Unterstuetzungssysteme fuer den Piloten", Braunschweig, 21.-25.09.1992. Volltext nicht online. |
Köpp, F. (1992) The European Lidar Airborne campaign ELAC'90. In: Vortrag. Speciality Meeting on airborne Radars and Lidars, Toulouse, France, 7-10 July 1992. Volltext nicht online. |
Köpp, F. (1992) Overall review of the campaign ELAC'90. ELAC'90 Final Workshop Noordwijk, 20.10.1992. Volltext nicht online. |
Kührt, E. and Keller, H.U. (1992) Dust Mantles on Comets. DPS 92, München. Volltext nicht online. |
Kührt, E. and Keller, H.U. (1992) Cometary Activity and Dust Mantle Build-up. COSPAR '92. Volltext nicht online. |
Kührt, E. and Kochan, H. and Lorenz, E. and Möhlmann, D. (1992) Strukturen einer simulierten Kometenoberflaeche und physikalische Konsequenzen. In: Verhandlungen der Deutschen Physikalischen Gesellschaft (1992) 4. 56. Physikertag, Berlin, 1992.. Volltext nicht online. |
Kührt, E. and Kochan, H. and et.al., (1992) Strukturen einer simulierten Oberflaeche: Variabilitaet und phys. Konsequenzen. AEP-Fruehjahrstagung der Deutschen Phys. Ges. 30.3.-2.4.1992, TU Berlin. Volltext nicht online. |
Kührt, E. and Lorenz, E. (1992) KOSI 9 IR Measurements. 7 Kometenwerkstatt, Neustadt/W., 29. Juni-1. Juli 1992.. Volltext nicht online. |
Küpper, A. and Eckert, D. (1992) Wall Correction Method for Models with Propeller Induced Slipstream. In: European Forum on Wind-Tunnels and Wind-Tunnel Test Techniques, Southampton, 14-17 September 1992. Proceedings (1992). RAeS. London. Volltext nicht online. |
L
Lammering, R. (1992) Optimale Positionierung von Aktuatoren zur aktiven Schwingungsdaempfung von Fachwerkstrukturen. GAMM-Tagung 1992, 24.03.-29.03.1992, Leipzig, (Gesellschaft fuer angewandte Mathematik + Mechanik). Volltext nicht online. |
Lammering, R. (1992) Optimal Placement of Piezo-Electric Actuators in Vibration Control. First European Conference on Smart Structures and Materials, Glasgow, Scotland, May, 12-14, 1992.. Volltext nicht online. |
Lammering, R. (1992) Berechnung und Optimierung von Strukturen mit integrierten piezoelektrischen Stellgliedern. Mechanik-Kolloquium der Niedersaechsischen, Hamburger und Berliner Hochschulen, 25.01.1992, Goettingen, Max-Planck-Institut fuer Stroemungsforschung.. Volltext nicht online. |
Lammering, R. (1992) Structural Analysis and Optimization of Adaptive Structures by use of the Finite Element Method. AGARD SMP Specialists' Meeting on Smart Structures for Aircraft and Spacecraft, Lindau, Germany, October 5-9, 1992.. Volltext nicht online. |
Lanari, R. (Vortragender) *): Moreira, J., (1992) Motion Error Extraction From the Signum-Coded SAR Raw Data. IEEE, Piscataway, N.J.. Vortrag, gehalten auf: IGARSS '92, Houston, Texas, 26.-29.5.92. Proc.: IEEE Cat.Nr. 92 CH 3041-1, Vol. I. Volltext nicht online. |
Lange, F. and Hirzinger, G. (1992) Iterative Self-Improvement of Force Feedback Control in Contour Tracking. In: Proc. IEEE Int. Conf. on Robotics and Automation. IEEE Int. Conf. on Robotics and Automation, Nizza, 10.-15.05.92. Volltext nicht online. |
Lange, H.-H. (1992) Einbindung von Hard-/Software in die Echtzeitsimulation. CCG-Lehrgang LR 11.01 "Flug- und Systemsimulation", Braunschweig, 23.-27.03.1992. Volltext nicht online. |
Lange, T. and Schlegel, C. (1992) Active Suspension Design for a Large Space Structure Ground Test Facility. In: Fifth Annual NASA/DOD CSI (Controls-Structures Interaction) Technology Conference. Volltext nicht online. |
Langer, H.-J. and Kube, R. (1992) HHC Effects on Hub and Blade Loads. In: Proceedings of the 18th European Rotorcraft Forum, Avignon, France, 15 - 18 September 1992. Volltext nicht online. |
Langnickel, U. and Boehmer, M. and Funken, K.-H. (1992) Solare Dampfreformierung von Methan. Darstellung von Testergebnissen. 8. Internationales Sonnenforum, Berlin, 30.06. - 03.07.92. Volltext nicht online. |
Langnickel, U. and Funken, K.-H. (1992) Die Guete der Solarenergiewandlung beim solaren Steam-Reforming von Methan unter transienten Bedingungen. DECHEMA, Jahrestagung 19922 Karlsruhe, 3.-5.06.92. Volltext nicht online. |
Langnickel, U. and Funken, K.-H. and Ploetz, F. (1992) Evaluation of Solar Chemical Reactions Exemplified by Means of the Solar Steam Reforming of Methane. 6th International Symposium on Solar Thermal Concentrating Technologies, Mojacar, Spain, 28th Sept. - 2nd Oct. 1992. Volltext nicht online. |
Langnickel, U., Boehmer, M., and Funken, K.-H. (1992) Solare Dampfreformierung von Methan. Darstellung von Testergebnissen. In: Tagungsbericht Bd. 2, 8. Internationales Sonnenforum, Berlin, 30. Juni - 3. Juli 1992, pp. 1352-1357. DGS-Sonnenenergie Verlags-GmbH, Muenchen. Volltext nicht online. |
Lechner, C. (1992) Untersuchungen am TPS 7.1. Kolloquiumsvortrag bei SM-AT, Köln-Porz, 03.09.1992. Volltext nicht online. |
Legge, H. (1992) Force and Heat Transfer on a Delta Wing from Continuum to Free Molecular Flow. 18th Rarefied Gas Dynamics Syposium (RGD), Vancouver/Canada, 26.7.- 31.7.92; vorgesehen zur Veröffentlichung in der RGD-Reihe. Volltext nicht online. |
Legge, H. (1992) Force and Heat Transfer on a Delta Wing in Rarefied Flow. In: Vorgesehen zur Veröffentlichung in: Workshop on Hypersonic Flows for Reentry Problems, Part II. Springer-Verlag. Springer - Verlag Berlin. Volltext nicht online. |
Lehner, M, Gill, R.S., (1992) Semi-Automatic Derivation of Digital Elevation Models from Stereoscopic 3-Line Scanner Data. American Society for Photogrammetry and Remote Sensing. Volltext nicht online. |
Lehner, M., Gill, R.S., (1992) Semi-Automatic Derivation of Digital Elevation Models from Stereoscopic 3-Line Scanner Data. ESA Publications Division. Volltext nicht online. |
Leucht, R. and Peters, M. and Dudek, H.J. (1992) Probleme bei der Entwicklung von hochwarmfesten SiC-Faserverstaerkten Titan-Basislegierungen. DGM-Symposium, Chemnitz, 17.-19.06.1992. Volltext nicht online. |
Leuchter, O.(1) and Amram, K.(1) and Thomas, P. (1) ONERA (1992) Etude theorique et experimentale du comportement des particules a la traversee d'une onde de choc. 3 eme Congres Francophone de Velocimetrie Laser ONERA CERT/DERMES 2 avenue Edouard Belin. B.P. 4025, 31055 Toulouse Cedex. Volltext nicht online. |
Leyendecker, H. (1992) Flugregelungssysteme fuer Hubschrauber. CCG-Lehrgang "Moderne Unterstuetzungssysteme fuer den Piloten", Braunschweig, 21.09.-25.09.1992. Volltext nicht online. |
Li Ye *., and Prinz, R. (1992) Fatigue delamination growth of graphite/epoxy laminates under tension-compression loading.(in chinesisch). In: Proc. of the 7th National Conference of Composite Materials. NCC Dalian China 1992.. Volltext nicht online. |
Li Ye*., and Prinz, R. * (1992) Mode II energy release rate for interlaminar delamination growth of graphite/epoxy composites. In: Proceedings of the Second International Symposium on Composite Materials Structures, Beijing 1992., pp. 376-381. Volltext nicht online. |
Lin, Y. (1992) Beruecksichtigung von Turbulenz bei der Identifizierung der DO 128. Kolloquium des Sonderforschungsbereichs 212, TU Braunschweig, 05.03.1992. Volltext nicht online. |
Lindermeir, Erwin (1992) Basic measurements for the determination of Concentrations of trace gases from emission spectra. In: SPIE Proceedings, pp. 337-339. SPIE The Society of Photo-Optical Instrumentation Engineers. Volltext nicht online. |
Lindermeir, Erwin and Tank, Volker and Haschberger, Peter (1992) Contactless measurement of the spectral emissivity and temperature of surfaces using a Fourier transform infrared spectrometer. In: SPIE Proceedings, 1682, pp. 354-364. Volltext nicht online. |
Lingner, S. (1992) Petrographic Composition of the Early Highlands Court of the Lunar Meteorites Source Region(s). In: Bulletin of the American Astronomical Society (BAAS) 1992 2nd Internat. Planetary Science Conf. 24th ASS-Meet.,München,Okt.92. Volltext nicht online. |
Lippmann, R. (1992) Aspekte der Bildcodierung bei Video-Luftbildszenen. Workshop Bildcodierung, Institut fuer Nachrichtentechnik der DLR, Oberpfaffenhofen, 8.7.92. Volltext nicht online. |
Lippmann, R. (1992) Kombinierte Praediktions- und Transformationscodierung. 15. Arbeitsgruppensitzung "Bildaufklaerung" des BMVG, Braunschweig, 12.-13.-10.1992. Volltext nicht online. |
Lippmann, R. and Doergeloh, H. (1992) Reconstruction of Low-Frame-Rate Aerial Scenes Using Motion Stereo. In: Proceedings of the International Symposium on Three Dimensional Image Technology and Arts, Tokyo/Japan, 5.-7.2.92. Volltext nicht online. |
Lodge, J. (1) and Hoeher, P. and Hagenauer, J. (1992) The Decoding of Multidimensional Codes Using Separable Map "Filters". In: Proc. of the 16th Biennial Symp. on Comm., Canada,, pp. 343-346. 16th Biennial Symposium on Comm.; 27. - 29.5.1992 in Kingston, Canada. Volltext nicht online. |
Loeser, W. and Volkmann, T. and Herlach, D.M. (1992) Erstarrungsverhalten unterkuehlter Fe-Cr-Ni Schmelzen. DGM Hauptversammlung, 1992-06-09 - 1992-06-12, Hamburg. Volltext nicht online. |
Loeser, W.* and Volkmann, T. and Herlach, D.M. (1992) Solidification and Metastable Phase Formation of Highly Undercooled Fe-Cr-Ni Alloy Melts. VIIIth European Symposium on Materials and Fluid Sciences in Microgravity Bruessel, 13.-17.4.1992. Volltext nicht online. |
Lohmann, D. (1992) Prediction of Ducted Radiator Fan Aeroacoustics with a Lifting Surfaces Method. DGLR, Bonn. DGLR/AIAA 14th Aeroacoustics Conference, Aachen, May 11th-14th, 1992. Volltext nicht online. |
Lohmann, D. (1992) Aeroakustische Optimierung eines Geblaeses. Zentrums-Kolloquium DLR-Goettingen, Goettingen, 19.11.1992. Volltext nicht online. |
Lohmann, D. (1992) Ein numerisches Verfahren zur Berechnung der Aeroakustik von Geblaesen. Sitzung des DLGR Fachausschusses T 2.4, "Strömungsakustik/ Fluglärm, DLR, BS, Institut SM-EA, 12.11.1992.. Volltext nicht online. |
Lohoefer, G. (1992) Force and Power Efficiency of Micro-g Electromagnetic Levitation Coils. Proceedings of the VIIIth European Symposium on Materials and Fluid Sciences in Microgravity (Bruessel, April 1992). Volltext nicht online. |
Lohoefer, G. and Egry, I. (1992) Measuring Thermophysical Properties of Undercooled Liquid Metals in Microgravity. Experimental Methods for Microgravity Materials Science Research Proceedings of 4th Int. Symp. San Diego, 1992. Volltext nicht online. |
Longo, J. M. A. (1992) Viscous Transonic Flow Simulation Around a Transport Aircraft Configuration. In: Deutscher Luft- und Raumfahrtkongress. DGLR-Jahrestagung 1992, Bremen, 29.09.92-2.10.92. Volltext nicht online. |
Longo, J. M. A. (1992) Simulation of Complex Inviscid and Viscous Vortex Flow. In: IUTAM Symposium on Fluid Dynamics of High Angle of Attack. Volltext nicht online. |
Lorenz, B. and Schiewe, A. and Manzey, D. (1992) Beurteilung mentaler Beeintrchtigung unter extremen Umweltbedingungen: Eine einzelfallorientierte Leistungsanalyse. In: DARA Symposium 1991: Statusseminar "Forschung unter Weltraumbedingungen". CPCm, RWTH Aachen, Aachen, Deutschland. Volltext nicht online. |
Lorenz, D. (1992) The Spacelab-1 Metric Camera Mission, a Source for Stereoscopic Earth and Cloud Photos from Space. Convention of the National Stereoscopic Association, Fort Wayne, Indiana, USA, August 14-16, 1992. Volltext nicht online. |
Loth, C. and et. al., (1992) WIND, an Airborne Coherent Doppler Lidar for Atmospheric Applications. Lidar for Remote Sensing Berlin, June 24 - 26, 1992. Volltext nicht online. |
Loth, C. and et.al., (1992) WIND an Airborne Doppler Lidar for Atmospheric Applications Developed in French-German Cooperation. Jour en Josas, France, 15.4. - 19.6.1992. Volltext nicht online. |
Lotz-Iwen, H.-J. and Dech, S. and Holz, A. and Glaser, R. (1992) Information Capability of NOAA-AVHRR data for monitoring oceanographic and atmospheric pollution. In: PORSEC- '92 Proceedings of the Conference for Pacific Ocean Environments & Probing Okonawa, Japan, pp. 790-795. Volltext nicht online. |
Lueen, L. (1992) Informationsmanagement in der betrieblichen Praxis. DGD-ONLINE-Tagung im Rahmen der Messe INFOBASE '92, Frankfurt a. M., 28. April 1992. Volltext nicht online. |
Luepfert, E. and Funken, K.-H. (1992) Kinetische Untersuchungen zur Abfallschwefelsaeure-Spaltung mit konzentrierter Solarstrahlung. 7. Sitzung d. Schwerp. Solare Chemie u. Solare Materialuntersuchung der AG-Solar NRW Muelheim/Ruhr, 14.10.1992. Volltext nicht online. |
Lutz, E. (1992) Land Mobile Satellite Communications Systems and Services. In: Proc. of the European Intern. Space Year Conf. (ISY), pp. 51-55. European Intern. Space Year Conference, 30.3. - 4.4.1992 in Muenchen(Sat. Symp. 1). Volltext nicht online. |
Lutz, E. (1992) PROMETHEUS - Forschung fuer den Strassenverkehr der Zukunft. Wiss. Kolloquium am 9.11.92 in OP. Volltext nicht online. |
Löllgen, H.(1) and Kuklinski, P. and Dirschedl, P.(1) and Damann, V. and Klein, K E. (1992) Sportmedizin und Raumfahrtmedizin: Gemeinsame Fragen und Wechselwirkungen. In: Hollmann et al.: Sportmedizin: Gestern-Heute-Morgen, pp. 1-4. Symposium Sportmedizin Gestern-Heute-Morgen, Oberhof/Thüringen, 25.-27.09.92. Volltext nicht online. |
Lückerath, R. and Kreutner, W. and Meier, W. and Stricker, W. (1992) CARS N2 Thermometry in Practical Flames up to 300 kW Thermal Load. 11th European CARS Workshop, Florence, Italy, 1992.. Volltext nicht online. |
Löser, W. and Volkmann, T. and Herlach, D.M. (1992) Solidification and metastable phase formation of highly undercooled Fe-Cr-Ni alloy melts. In: Proceedings of the 8th European Symposium on Materials Sciences under Microgravity, 333, pp. 655-663. 8th European Symposium on Materials Sciences under Microgravity, Brüssel (B). Volltext nicht online. |
M
Maaß, C. and Dörnbrack, A. and Schumann, U. (1992) Grobstruktursimulation turbulenter Strömungen über welligem Untergrund. Deutsche Meteorologen-Tagung, Berlin, 16.-20.3.92. Volltext nicht online. |
Magens, E. (1992) Entwicklung eines eigenen Rechenverfahrens zur Simulation von H2O-CARS Spektren bei hohen Temperaturen. LIF 5, 27.-28.01.92, Lampoldhausen . Volltext nicht online. |
Magens, E. (1992) Simulation of H2O-Spectre. Meeting HERMES diagnostic group, 24.02.1992, Köln-Porz. Volltext nicht online. |
Magens, E. and Leipertz, A. (1992) Evaluation of accumulated rotational CARS spectre taken in mixing regions of flames. XI'th CARS-Workshop, 23.-25.02.1992, Florenz, Italy. Volltext nicht online. |
Magnani, P. G. (1992) Laboratory Cold Core Sampling Investigation of the Rosetta Space Mission COSPAR, Washington, 28.8.-5.9.92. Volltext nicht online. |
Magnani, P.G. and et.al., (1992) Laboratory Sampling Investigations as Preparation of the Rosetta Space Mission. XVII General Assembly, Edinburgh, 6.-10.4.1992. Volltext nicht online. |
Maisenhaelder, F. (1992) Aktueller Stand der Lasertechnik. Lehrgang "Erfahrungsaustausch fuer Lehrschweisser", Vortrag bei der S LV Fellbach, 28.10.92. Volltext nicht online. |
Maisenhaelder, F. (1992) Materialbearbeitung mit Lasern - Einfuehrung, Beispiele. Seminar der HK-Reutlingen, 27.5.92. Volltext nicht online. |
Maisenhaelder, F. (1992) Aktueller Stand der Lasertechnik zum Schweissen und Schneiden. Ergaenzungslehrgang "Europaeischer Schweissfachingenieur", SLV Fellba ch, 22.6.92. Volltext nicht online. |
Maisenhaelder, F. (1992) Materialbearbeitung mit dem Laser. Seminar "Die Anwendung d. Lasers i.d. Schweiss- u. Schneidtechnik", S LV Mannheim, 20.5.92. Volltext nicht online. |
Maisenhaelder, F. (1992) Aktueller Stand der Lasertechnik. Lehrgang "Erfahrungsaustausch für Lehrschweisser", SLV Fellbach, 22.5 .92. Volltext nicht online. |
Maisenhaelder, F. (1992) Lasertechnik zum Schweissen und Schneiden. Sonderlehrgang "Schweissaufsichtspersonen - Erfahrungsaustausch", SLV Fellbach, 10.4.92. Volltext nicht online. |
Maisenhaelder, F. (1992) Materialbearbeitung mit dem Laser, Oberflaechenbehandeln, Haerten, Umschmelzen, Beschichten, Beschriften. Seminar: Die Anwendung des Lasers in der Schweiss- und Schneidtechnik , SLV Mannheim, 6.11.92. Volltext nicht online. |
Maisenhaelder, F. (1992) Aktueller Stand der Lasertechnik zum Schweissen und Schneiden. Ergaenzungslehrgang "Europaeischer Schweissfachingenieur, SLV Fellbac h, 2.11.92. Volltext nicht online. |
Maisenhaelder, F. (1992) Materials Processing by CO Lasers. In: Proceedings of LAMP 92, 7.-12. Juni 1992, Nagaoka, Japan, pp. 54-51. SEIEI Printing Co., Ltd., Osaka, Japan. LAMP 92, 7.-12. Juni 1992, Nagaoka, Japan . Volltext nicht online. |
Maisenhaelder, F. (1992) Materials Processing by CO Lasers. Seminarveranstaltung des Institute of Laser Technology, Juni 1992, Tokyo, Japan. Volltext nicht online. |
Maisenhaelder, F. (1992) Materials Processing by CO Lasers. Conference LASERS ADVANCED MATERIALS PROCESSING, June 1992, Nagaoka, Japan. Volltext nicht online. |
Maisenhaelder, F. (1992) Materials Processing by CO Lasers. Seminarveranstaltung des INSTITUTE FOR INNOVATION AND RESEARCH, Juni 1992, Tokio , Japan. Volltext nicht online. |
Maisenhälder, F. (1992) Wirkungsweise der für die Materialbearbeitung relevanten Laser. Seminar der HK Stuttgart "Lasertechnik im Handwerk", am 3.4.92. Volltext nicht online. |
Mannstein, H. (Vortragender) and Kriebel, K.T. (1992) On the Modulation Transfer Function of the MSG-HRVIS Channel. In: Proc. 9th Meteosat Scientific Users' Meeting, Locarno, Switzerland, 15.-18.9.1992, pp. 409-416. 9th Meteosat Scientific Users's Meeting, Locarno, Switzerland, 15.-18.8.1992. Volltext nicht online. |
Mansfeld, G. (1992) Application Fibre Optics in Flight Controls. AGARD-Cranfield Special Short Course of Flight Test Instrumentation Cranfield, Bedfordshire MK43 OAL, UK, 24.-28.2.92. Volltext nicht online. |
Manzey, D. and Schiewe, A. (1992) Psychological Training of German Science Astronauts. In: Acta Astronautica. Pergamon Press Ltd., London, England. Volltext nicht online. |
Marci, G. (1992) Reliability and Structural Integrity of Advanced Materials. In: Experimental determination of Keff, pp. 420-426. EMAS, West Midlands, United Kingdom. European Conference on Fracture ECF 9, Reihe 1 21.- 25.9.1992, Varna, Bulgaria. Volltext nicht online. |
Mardorf, L. (1992) Thermodynamische Grundlagen und Entwicklung einer einstufigen Ammoniak/Wasser/Absorptionswaermepumpe. Seminar fuer Waermeumwandlungssysteme, Technische Universitaet Muenchen, Physik-Department I, 30. Juni 1992. Volltext nicht online. |
Mardorf, L. and Peter, Th. (1992) Experimentelle Untersuchungen und mathematische Simulation der Waerme- und Stofftransportvorgaenge an bereiften Luftkuehlern. In: DKV-Tagungsbericht, Band 2, 2, pp. 579-590. Kälte- und Klimatagung, 18. - 20.11.92, Bremen. Volltext nicht online. |
Markwitz, W. and Schreier, G. (1992) Design and Implementation of a Data and Information Management System for the German Remote Sensing Data Center. In: ETC'92 (European Telemetry Confernce) Garmisch-Partenkirchen, Germany, May 12 to 14, 1992. Volltext nicht online. |
Marquardt, P. and Schilz, J. and Mahr von Staszewski, G. (1992) Microgravity assisted studies on dielectric and elastic properties of free and matrix-embedded nanocrystals and their application as tunable sensors and detectors.- A proposal for a microgravity experiment -. Low G Forum Bonn, 26. Juni 1992. Volltext nicht online. |
Mathiak, F.U. and Fuchs, F.A. and Ott, W. and Trautmann, K.-H. and Maldfeld, E. and Nowack, H. (1992) Constitutive Equations for Elastic-Plastic Material Behaviour under Extremely High Multiaxial Loads and Fatigue Loads. In: Proc. of the Third Int. Conference Low Cycle Fatigue and Elasto-Plasic Behavoiur of Materials (1992) pp. 418-423, pp. 418-423. Elsevier Science Publishers Ltd. Crown House, Linton Road, Barking,. Third International Conference Low Cycle Fatigue and Elasto-Plastic Behaviour of Materials, September 7-11,1992, Berlin. Volltext nicht online. |
Mathiak, F.U. and Fuchs, F.A. and Trautmann, K.-H. and Frauenrath, H. (1992) Biaxpruefung von Tiefziehstaehlen des Karosseriebaus. In: Proc. (1992), pp. 139-147. Deutsche Gesellschaft für Materialkunde, Oberursel. Werkstoffprüfung 1992, 3. und 4. Dezember 1992, Bad Nauheim. Volltext nicht online. |
Maurer, F. and Henckels, A. (1992) Experimental Results on Hypersonic Shock/Vortex/Boundary-Layer Interaction. 15th DEA-Meeting "Viscous and Interacting Flow Field Effects", MBB Munich, 13-15 July 1992. Volltext nicht online. |
Mayerhofer, W. and Beth, M.-U. (1992) Design of an e-beam-controlled 1kW Ar:Xe laser. In: Proceedings 9th Int. Symp. on Gas Flow and Chem. Lasers (1992). 9th International Symposium on Gas Flow and Chemical Lasers, Sept 1992, Heraklion, Crete, Greece. Volltext nicht online. |
McEwen, A.(1) and Gaddis, L.R.(1) and Neukum, G. and Hoffmann, H. and Pieters, C.M.(2) and Head, J.W.(2) (1992) Lunar craters and soils: ages, colors, and regolith thicknesses. In: Lunar and Planetary Science Conference XXIII Abstract Volume. Volltext nicht online. |
McEwen, A.S.(1) and Greeley, R.(2) and Head, J.W.(3) and Pieters, C.M.(3) and Fischer, E.M.(3) and Johnson, T.V.(4) and Neukum, G. and GLL SSI Team (1992) Galileo SSI Lunar Observations. In: Copernican Craters and Soils. Lunar and Planetary Science Conference, Houston, 15.-19. März 1993. Volltext nicht online. |
McIntyre, T.J. and Kortz, S. and Beck, W.H. and Eitelberg, G. and Lacey, J. (1992) Initial Calibration Results of the High Enthalpy Shock Tunnel in Goettingen (HEG). Proceedings of IUTAM Symposium, "Aerothermochemistry of Spacecraft and Associated Hypersonic Flows", Marseille, September 1-4, 1992. Volltext nicht online. |
Meerkötter, R. and Büll, R. and Wendling, P. (1992) Detection of Polar Stratospheric Clouds from Satellite. In: European International Space Year Conference, München, 30.3.-4.4.1992, pp. 117-121. Volltext nicht online. |
Mehnert, A. and et. al., (1992) Diode - Pumped Nd: YAG Lidar for Airborne Cloud Measurements. 16th International Laser Radar Conference, Cambridge, Massachusetts, 20-24 July 1992. Volltext nicht online. |
Meier, G. E. A. (1992) Instationaere Stroemungen - Eine Zukunftsaufgabe. In: 8. DGLR-Symposium "Strömungen mit Ablösungen" (AG STAB) 10.-12. Nov. 1992, Köln. Proceeding erschienen: Kurzfassung zum 8.Fach-Symposium der DGLR AG STAB, 10.-12.Nov.1992 (92-04-067). Vortrag an der Technischen Universität Wien im Kolloquium über neuere Arbeiten auf dem Gebiet der Mechanik und Strömungslehre, Wien 12. März 1993. Volltext nicht online. |
Meier, G.E.A. and Zhang, K.Y. and Lent, H.-M. and Obermeier, F. and Schürmann, O. (1992) Transonic Blade Vortex Interaction Noise: New Experimental Results. In: DGLR/AIAA 14th Aeroacoustic Conference, May 11-14, 1992, Aachen. AIAA, S.W. Washington D.C.20024, USA. DGLR/AIAA 14th Aeroacoustic Conference, 11.-14. Mai 1992, Aachen. Volltext nicht online. |
Meier, U. (1992) Bericht ueber USA-Entsendung; NO-Emission und -Quenching. DLR-Kolloquium LIF 4, Göttingen, 18.02.1991.. Volltext nicht online. |
Meier, U. and Kohse-Höinghaus, K. and Plath, I. (1992) Quantitative 2D-Messungen mit LIF. DLR-Kolloquium LIF 5, Lampoldshausen, 1992. Volltext nicht online. |
Meier, U. and Plath, I. and Kohse-Höinghaus, K. (1992) Determination of Minority Species Concentrations and Temperature in Combustion Systems by Laser-Induced Fluorescence. In: Proc. ONERA-DLR-NASA-VKI Advanced Research Workshop on New Trends in Instrumentation for Hypersonic Research (1992). ONERA-DLR-NASA-VKI Advanced Research Workshop on New Trends in Instrumentation for Hypersonic Research, Toulouse, 24 April-1 May 92. Volltext nicht online. |
Meier, U. and Plath, I. and Kohse-Höinghaus, K. (1992) Degenerate Four-Wave Mixing (DFWM) on NO. DLR-Kolloquium LIF 5, Lampoldshausen, 1992. Volltext nicht online. |
Meier, W. and Plath, I. and Stricker, W. (1992) Single-Shot CARS Temperature Measurements in a Turbulent Stagnation Flame of 20 kW Thermal Load. In: Practical Considerations.. 10th European CARS Workshop, Garching, 18-19 March 1991. Volltext nicht online. |
Meier, W. and Prucker, S. and Stricker, W. (1992) Species Concentration and Temperature Determination in Turbulent Flames by Single Pulse Spontaneous Raman Spectroscopy. 11th European CARS Workshop, Florence, March 1992. Volltext nicht online. |
Meinecke, W. (1992) Status of the 2.5 MW Volumetric Receiver Test (TSA). In: SSPS Technical Report Nr. 1/92, IEA SolarPACES, Task 3 - Working Group Meeting, Tabernas/Almeria, 23. Sept. 92. Volltext nicht online. |
Meinecke, W. (1992) Technical Aspects of Solar Thermal Technologies for Electricity Generation. In: 6th International Symposium on Solar Thermal Concentrating Technologies, Mojacar, Spanien, 28.09. - 02.10.92. Volltext nicht online. |
Meinecke, W. (1992) Economic Aspects of Solar Thermal Technologies for Electricity Generation. In: 6th International Symposium on Solar Thermal Concentrating Technologies, Mojacar, Spanien, 28.09. - 02.10.92. Volltext nicht online. |
Meinecke, W. (1992) Wirtschaftliche Aspekte solarthermischer Anlagentechnologien zur Stromerzeugung. In: 8. Internationales Sonnenforum, DGS, Berlin, 30.06. - 03.07.92. Volltext nicht online. |
Meinecke, W. (1992) Proceedings of the First Meeting of SolarPACES - Task 3 - Working Group on "Solar Technology and Applications". In: SSPS Technical Report Nr. 1/92, IEA SolarPACES Task 3 Operating Agent DLR. D L R - Koeln. Volltext nicht online. |
Meinköhn, D. (1992) Dynamic Wetting Phenomena. Workshop SFB 123; 30.11. - 11.12.1992; Universitaet Heidelberg. Volltext nicht online. |
Meinköhn, D. (1992) Geometrische Konzepte und Modellierung: Verbrennungsprozesse in mikroheterogenen Systemen. Kolloquium 13.10.1992; Chemische Gesellschaft; Universitaet Heidelberg. Volltext nicht online. |
Meinköhn, D. (1992) Microstructure Effects in Heterogeneous Combustion. Seminar 09.09.1992; Department of Fuel and Energy; Leeds University; England. Volltext nicht online. |
Meinköhn, D. (1992) Exothermic Surface Reactions: The Rupture of Liquid Product Layers. EUROMECH 294 "Theoretical Mechanics of Combustion"; 01.09. - 04.09.1992; Bristol University; England. Volltext nicht online. |
Meinköhn, D. (1992) Geometric Concepts in Microheterogeneous Combustion. EUROMECH 294 "Theoretical Mechanics of Combustion"; 01.09. - 04.09.1992; Bristol University; England. Volltext nicht online. |
Meinköhn, D. (1992) Phasenraumgeometrie und mikroheterogene Reaktions-Diffusionssysteme. Fakultaet fuer Physik; Universitaet Bielefeld; Seminar 27.05.1992. Volltext nicht online. |
Meinköhn, D. (1992) Analogien zwischen Verbrennungs- und Deformationsprozessen. Sonderkolloquim 06.02.1992; Bundesanstalt für Materialforschung BAM; Berlin. Volltext nicht online. |
Meinköhn, D. (1992) Theoretical Aspects of Ignition/Extinction Processes. International Workshop on Heterogeneous Combustion; 06.01. - 12.01.1992; Dead Sea; Israel. Volltext nicht online. |
Meischner, P. and Hauf, T. and Jaeschke, W. and Kriebel, T. and Mauser, W. and Nithack, J. and Pruppacher, H. and Schroth, A. and Schumann, U. (1992) CLEOPATRA - A Step towards GEWEX on the Regional Scale. In: Proc. European International Space Year, pp. 317-322. European 'International Space Year', Conf. 1992, München, 30.3.-4.4.1992. Volltext nicht online. |
Meischner, P. and Hauf, T. and Jaeschke, W. and Kriebel, T. and Mauser, W. and Nithack, J. and Pruppacher, H. and Schroth, A. and Schumann, U. (1992) CLEOPATRA - A Step Towards GEWEX on the Regional Scale. In: Proc. of the Central Symposium of the International Space Year Conference, Munich 1992, pp. 317-322. Central Symp. of the Internat. Space Year Conference, Munich, 30.3.-4.4.1992, Munich, Germany, 30.3.-4.4.92, ESA SP-341. Volltext nicht online. |
Meischner. P., and Hagen, M.(Vortragender) and Bringi, U.N.(*) (1992) Microphysics of Snow Formation of an Alpine Upslope Case. In: Proc. 14th Int. Conference on Clouds and Precipitation, pp. 200-203. McGill Univ., Montreal, Kanada. 14th International Conference on Clouds and Precipitation, Montreal, Canada, 17.-21.8.1992. Volltext nicht online. |
Melcher, J. (1992) Intelligente Struktursysteme - Potential und Chancen einer neuen Technologie. Universitaet Stuttgart, Fakultaet fuer Luft- und Raumfahrttechnik, Kolloquium am 04.06.1992.. Volltext nicht online. |
Melcher, J. (1992) Adaptive on-line System Identification of Aerospace Structures using MX Filters. IFAC Symposium on Aerospace Control in Munich/Ottobrunn, Germany, on Sept. 7-11, 1992.. Volltext nicht online. |
Melcher, J. (1992) Adaptive Digital Controllers for Smart Structures. Zentrumskolloquium im Jet Propulsion Laboratory, Pasadena, CA, USA, am 04. November 1992.. Volltext nicht online. |
Melcher, J. (1992) Active Vibration Isolation Using Multifunctional Interfaces and Adaptive Digital Controllers. Conference of the Third International Conference on Adaptive Structures, San Diego, CA, USA, Nov. 9-11, 1992.. Volltext nicht online. |
Melzer, E. (1992) Der Hochdruckwindkanal Goettingen (HDG). Aerodynamisches Seminar, RWTH Aachen, 24.11.1992. Volltext nicht online. |
Meyer, H. (1992) Helicopter Flight Test Instrumentation. In: Proceedings of the European Telemetry Conference ETC 92, Garmisch-Partenkirchen, 12 - 14 May 1992, pp. 443-454. Volltext nicht online. |
Meyer, J.-Th. (1992) Measurements of Particle Densities and Flow Directions in Free-Jets and in the Background Gas. 18th Rarefied Gas Dynamics Symposium (RGD), Vancouver/Canada, 26.7.-31.7.92, vorgesehen zur Veroeffentlichung in der RGD-Reihe.. Volltext nicht online. |
Michel, U. (1992) Prediction and Reduction of Supersonic Jet Noise. In: DGLR-Bericht 1992-03 (1992). wird eingereicht beim Journ. of Sound and Vibration. Keynote Paper DGLR/AIAA 14th Aeroacoustics Conference 11-14.5.92, Aachen. Volltext nicht online. |
Michel, U, and Böttcher, J. (1992) Prediction of jet mixing noise in high speed flight. In: DGLR-Bericht 1992-03 (1992), pp. 846-853. DGLR. DGLR - AIAA 14th Aeroacoustics Conference, Aachen, 11.-14.5.92. Volltext nicht online. |
Michels, B.I. and Jochum, A.M. (1992) Fluxes of Heat and Water Vapor in a Convective Mixed Layer Over Inhomogeneous Terrain. In: Proc. American Meteorological Society; 10th Symp. on Turbulence and Diffusion, 29.9.-2.10.1992, Portland, OR, USA, pp. 326-329. AMS, 10th Symposium on Turbulence and Dioffusion, 29.9.-2.10.1992, Portland, OR, USA. Volltext nicht online. |
Mikusch, E. (1992) Software Engineering als strukturierte Teamarbeit Die Entwicklung des Ground Support Program Equipment. Carl-Cranz-Gesellschaft -Seminar für Techniken, Methoden und Werkzeuge des Software Engineering, 07.-10.12.1992. Volltext nicht online. |
Mirra C., etal. (1992) User Support for The Columbus Precursor Missions. In: Proceedings of Satellite Symposium 4, pp. 245-249. ESA Publications Division, ESTEC, Noordwijk, The Netherlands. International Space Year Confernce, Munich, 30 March-4 April 1992. Volltext nicht online. |
Moher, M. (1) (1992) CDMA in a Terrestrial Mobile Environment. 1. Teil: IK am 22.7.92 in OP 2. Teil:IK am 29.7.92 in OP. Volltext nicht online. |
Montenbruck, O. and Eckstein, M. C. and Gonner, J.* (1992) The GeoControl System for Station Keeping and Colocation of Geostationary Satellites. Jet Propulsion Laboratory - Space Ops 92 Second International Symposium Ground Data Systems for Space Mission Operations, Pasadena, California, USA, November 16-20, 1992. Volltext nicht online. |
Moreira, A. (1992) A Real-Time Processor for the DLR's Airborne SAR. METEO, Toulouse, France. Vortrag gehalten auf: Speciality Meeting on Airborne Radars and Lidars, 7-10 July 1992, Toulouse, France Proc. of the Speciality Meeting on Airborne Radars and Lidars. Volltext nicht online. |
Moreira, A. (1992) Removing the Azimuth Ambiguities of Point Targets in Synthetic Aperture Radar Images. IEEE, Piscataway, N.J.. Vortrag, gehalten auf: IGARSS'92, Houston, Texas, 26.-29.5.92 Proc. IEEE Cat.Nr. 92 CH 3041/1, Vol. 1. Volltext nicht online. |
Moreira, A. (1992) SAR Image Processing with Suppression of the Azimuth Ambiguities. DLR, Oberpfaffenhofen, Germany. Vortrag, gehalten auf: Microwave Signature - 92, 1-3 July 1992, Igls-Innsbruck, Austria Proc. of the URSI Microwave Signature - 92 Conference. Volltext nicht online. |
Moreira, A. (1992) A Subaperture Algorithm for Real-Time SAR Processing. Vortrag, gehalten am TNO-FEL, Den Haag, Holland, am 4.12.92. Volltext nicht online. |
Moreira, A. and Misra, T. *) and Chowdhury, S. *) *) ISRO, Ahmedabad, India (Vortragender: Moreira, J. fuer Moreira, A.), (1992) Modelling and Performance Evaluation of a New Subaperture Approach for Real-Time SAR Processing. IEE, London, England. Vortrag, gehalten auf: Radar 92, 12-13 Oct. 1992, Brighton, England Proc. of the Internat. Radar Conference. Volltext nicht online. |
Moreira, A. (Vortragender) and Brodscholl, A. and Dorn, J. and Kochsiek, F. and Poetzsch, W. (1992) Airborne Real-Time SAR Processing Activities at DLR. IEEE, Piscataway, N.J.. Vortrag, gehalten auf: IGARSS '92, Houston, Texas, 26.-29.5.92 Proc. IEEE Cat.Nr. 92 CH 3041-1, Vol. I. Volltext nicht online. |
Moreira, J. (1992) On the Relationship Between Wave Pattern Motion and Optimum Focus of SAR Images of Ocean Waves. IEEE, Piscataway, N.J.. Vortrag, gehalten auf: IGARSS '92, Houston, Texas, 26.-29.5.92 Proc. IEEE Cat.Nr. 92 CH 3041-1, Vol. II. Volltext nicht online. |
Moreira, J. (1992) Der SAR-Prozessor des experimentellen SAR-Systems der DLR (E-SAR). Wissenschaftliches Kolloquium, DLR, Oberpfaffenhofen, 7.1.1992. Volltext nicht online. |
Moreira, J. (1992) Real Time PRF Control System for SAR. IEE, London, England. Vortrag, gehalten auf: Radar 92, Brighton, UK., 12.-13.10.92 Proc.: Radar 92, Conf.Publ.No. 365. Volltext nicht online. |
Moreira, J. (1992) Bewegungsextraktionsverfahren fuer Radar mit synthetischer Apertur. Vortrag, gehalten auf: TU Muenchen, Lehrstuhl fuer Mikrowellentechnik Muenchen, 9.1.92. Volltext nicht online. |
Moreira, J. (1992) Characteristics and Performance of Different Autofocus Methods. Vortrag, gehalten auf: Third SAXON-FPN Workshop, Kiel, 17.3.92. Volltext nicht online. |
Moreira, J. (1992) Genauigkeitsanforderungen an die Ortungs- und Lagebestimmung fuer Radarsensoren mit synthetischer Apertur (SAR). DGON, Sitzung 4-92 der ad-hoc-Gruppe Ortungs- und Navigationskomponenten in Fernerkundungsmissionen, Univ. der Bundeswehr Muenchen, Inst. f. Astronomische und Physikalische Geodaesie, Neubiburg, 13.11.92. Volltext nicht online. |
Moreira, J. and Buckreuß, S. (1992) Airborne SAR-Processing Facility at DLR. In: Specialty Meeting on Airborne Radars and Lidars, pp. 189-196. METEO, Toulouse, France. Specialty Meeting on Airborne Radars and Lidars, 7-10 July 1992, Toulouse, France. Volltext nicht online. |
Moreira, J. (Vortragender) and Alpers, W. *) (1992) On the Reflectivity Displacement Method for Measuring the Phase Velocity of the Dominant Ocean Wave. Vortrag, gehalten auf: Fourth SAXON-FPN Workshop at the Appl. Phys. Lab., Univ. of Washington, Seattle, Washington, USA, 29.9.-2.10.92. Volltext nicht online. |
Moreira, J. (Vortragender) and Alpers, W. *) (1992) Extraction of the Phase Velocity of the Dominant Ocean Wave from SAR Raw Data. DLR, OP, Germany. Vortrag, gehalten auf: Microwave Signature "92, URSI, Igls-Innsbruck, Austria, 1.-3.7.92. Proc.: Microwave Signature '92. Volltext nicht online. |
Mottola, S. and Di Martino, M.(1) and Gonano-Beurer, M. and Hoffmann, H. and Neukum, G. (1992) Ground-based Observations of 951 Gaspra. In: Asteriods, Comets, Meteors 1991CCD Lightcurves and Spectrophotometry with the Galileo Filters., pp. 421-424. Lunar and Planetary Institute, Houston, USA. Conference "Asteroids, Comets, Meteors", Flagstaff, 1991. Volltext nicht online. |
Muehleck, P. and Schuetz, H. (1992) Numerische Untersuchungen von Brennkammer-Duesenstroemungen bei Staustrahltriebwerken. In: Proceedings des 8. TECFLAM Seminars: Modellierung technischer Flammen, pp. 53-65. AGARD Paris. 13. November 1992 Darmstadt. Volltext nicht online. |
Mueller, R. (1992) DLR-Messtechnik am Laminarhandschuh der DO 228. In: DGLR. DGLR, Bonn. 8. DGLR-Fach-Symposium Stroemungen mit Abloesung, Koeln-Porz, 10.-12.11.1992. Volltext nicht online. |
Mueller, H.J. (Vortragender), Nithack, J., (1992) Backscatter Statistics of Agricultural Fields from two Frequency High Resolution SAR Images. Vortrag, gehalten auf Microwave Signature '92, Igls-Innsbruck, 1.-3.7.92, Austria Proc. Microwave Signature '92. Volltext nicht online. |
Muylaert, Voiron, Sagnier, Lourme, Papirnyk, Hannemann, B&u.tefisch, Koppenwallner, (1992) Review of the European Hypersonic Wind Tunnel Performance and Simulation Requirements. In: Proc. of the First European Symposium Aerothermodynamics for Space Vehicles, ESTEC, Noordwijk, The Netherlands, 28-30 May 1991, pp. 559-574. Volltext nicht online. |
Möhlmann, D. and Kochan, H. and Seidensticker, K.J. (1992) Laboratory Simulation of Cometary Process. COSPAR, Washington, August 1992. Volltext nicht online. |
Möller, U. and Hildmann, B.D. and Bähr, G. (1992) TEXUS 28 Experiment: Convections and Crystal Growth of Ge:Ga. In: Proc. of the 8th ELGRA Symposium on Materials and Fluid Sciences under Microgravity, ESA-SP-333 (1992). 8th ELGRA Symposium on Materials and Fluid Sciences under Microgravity, ULB Brussels, April 1992.. Volltext nicht online. |
Möhlmann, D. and Kochan, H. and Seidensticker, K. J. (1992) Simulation of Martian Surface-Atmosphere Interaction in a Space Simulator. COSPAR, Washingtin, August 1992. Volltext nicht online. |
Müller, Rupert and Reinartz, Peter and Kritikos, Georg and Schroeder, Manfred (1992) Image Processing in a Network Environment. ISPRS Congress, Washington, D.C., 1992, International Archives of Photogrammetry and Remote Sensing Volume XXIX, B2. Volltext nicht online. |
N
Nast, M. (1992) Möglichkeiten solarer Nahwärmekonzepte. In: Tagungsberichte Energieforum Pforzheim (Forum für Zunkunftsenergie Hrsg.), 17.09.92, Pforzheim. Energieforum Pforzheim, 17.9.1992. Volltext nicht online. |
Nast, P. M. (1992) Biobrennstoffe und Solare Nahwaerme. In: Tagungsbericht. "Erstes Syposium Biobrennstoffe und umweltfreundliche Heizanlagen" Regensburg, 23.-25.09.1992. Volltext nicht online. |
Nast, P.-M. (1992) Solare Nahwaerme und Biomasse. In: (Manuskript)- Eine Möglichkeit zur autarken Wärmeversorgung im ländlichen Raum -. 8. Int. Sonnenforum der DGS, Berlin, 30.06.-03.07.1992. Volltext nicht online. |
Nau, H. (1992) Differentielle Messungen (DGPS). Vortrag, gehalten auf: CCG-Lehrgang IT 11.33 "Satellitennavigation - Das Globale Positionierungs-System GPS-NAVSTAR und seine Anwendungen", Oberpfaffenhofen, 30.6.-2.7.92.. Volltext nicht online. |
Nau, H. (1992) Demonstration von GPS-Empfaengern. Vortrag, gehalten auf: CCG-Lehrgang IT 11.33 "Satellitennavigation - Das Globale Positionierungs-System GPS-NAVSTAR und seine Anwendungen", Oberpfaffenhofen, 30.6.-2.7.92.. Volltext nicht online. |
Nau, H. (1992) Die von den GPS- und GLONASS-Satelliten gesendete Information. Vortrag zum Lehrgang Nr. 16249/73.383 "Radio Ortung und Navigation", Technische Akademie Esslingen, Ostfildern (Nellingen), 9.-11.12.92.. Volltext nicht online. |
Nau, H. (1992) Messungen mit GPS und Demonstration. Vortrag zum Lehrgang Nr. 16249/73.383 "Radio Ortung und Navigation", Technische Akademie Esslingen, Ostfildern (Nellingen), 9.-11.12.92.. Volltext nicht online. |
Nau, H. (1992) Die von den GPS-Satelliten gesendete Information. Vortrag, gehalten auf: CCG-Lehrgang IT 11.33 "Satellitennavigation - Das Globale Positionierungs-System GPS-NAVSTAR und seine Anwendungen", Oberpfaffenhofen, 30.6.-2.7.92.. Volltext nicht online. |
Nau, H. (1992) Grundlagen der Positionsbestimmung. Vortrag, gehalten auf: CCG-Lehrgang IT 11.33 "Satellitennavigation - Das Globale Positionierungs-System GPS-NAVSTAR und seine Anwendungen", Oberpfaffenhofen, 30.6.-2.7.92.. Volltext nicht online. |
Nau, H. (Vortragender) and Unverdross, R. *) (1992) Satellitennavigation in der Zeitmesstechnik. DGON, Duesseldorf, Germany. Vortrag, gehalten auf: DGON Seminar: "Satellitennavigationssysteme", Potsdam, 20.-21.10.92. Proc.: Satelliten-Navigationssysteme, Grundlagen und Anwendungsmoeglichkeiten im Verkehrswesen und fuer Geowissenschaften. Volltext nicht online. |
Nehring, U. (1992) A Momentum Representation of Compressible Flows. 18th Rarefied Gas Dynamics Symposium (RGD), Vancouver/Canada, 26.7.-31.7.92, vorgesehen zur Veroeffentlichung in der RGD-Reihe.. Volltext nicht online. |
Neise, W. (1992) Experimentelle Bestimmung der akustischen Empfindlichkeit eines Mikrofons mit Turbulenzschirm (Schlitzohr) bei ueberlagerter Stroemung. Fortschritte der Akustik, DAGA 92, Berlin. DAGA 92, Berlin 31.3.-2.4.1992. Volltext nicht online. |
Neise, W. (1992) Review of fan noise generation mechanisms and control methods. Publications CETIM, Seulis, France. International Symposium on Fan Noise 1.-3.9.1992 Seulis, France. Volltext nicht online. |
Neubauer, N. (1992) Technologie des HeNe-Lasers. CCG-Kurs "Optische Sensoren", Braunschweig, 23.11.-27.11.92. Volltext nicht online. |
Neubert, J. (1992) Ultrastruktur des Vestibularorgans bei 30 Tage alten Schwerttrgern (Xiphophorus helleri): Verhalten von Xenopus-Larven gegenber unterschiedlichen Beschleunigungen. C.E.B.A.S./Aquarack-Meeting, Universität Bochum, Deutschland, 17.-18. 09.92. Volltext nicht online. |
Neubert, J. (1992) Apparative Voraussetzungen für Untersuchungen an aquatischen Wirbeltieren unter Schwerelosigkeit. Gravitationskolloquium, Universität Stuttgart-Hohenheim, 04.06.92. Volltext nicht online. |
Neukum, G. (1992) The Experiments HRSC and WAOSS on the Mars 94 and 96 Missions. In: Scientific Goals and Mission Conduct.. World Space Congress, COSPAR, Washington, DC, USA, 28 Aug. - 5 Sept. 1992. Volltext nicht online. |
Neukum, G. (1992) Bilder aus dem Weltraum. Donaueschingen, 21.10.92. Volltext nicht online. |
Neukum, G. (1992) The MArs 94 Camera-experiment and the need for laboratory simulation work. Mars Simulation Workshop, Bad Honnef, 27.-29.1.92. Volltext nicht online. |
Neukum, G. (1992) Gaspra's cratering history. In: Implications for the evolution of the asteroid belt.. European Geophysical Society, XVII General Assembly, Edinburgh, 6.-10.4.92. Volltext nicht online. |
Neukum, G. (1992) The Experiments HRSC and WAOSS on the Mars 94 and 96 Missions. In: Scientific goals and mission conduct.. European Geophysical Society, XVII Generall Assembly, Edinburgh, 6.-10.4.92. Volltext nicht online. |
Neukum, G. (1992) Neueste Ergebnisse der Galileo-Mission. Bayerische Volkssternwarte, München, 24.07.92. Volltext nicht online. |
Neukum, G. (1992) Die Planeten. Duetsches Museum München, 6.5.92. Volltext nicht online. |
Neukum, G. and Jaumann, R. and Hoffmann, H. (1992) Earth-based Multispectral and Photometric Observations of the Moon. World Space Congress, COSPAR, Washington, DC, USA, 28 Aug. - 5 Sept. 1992. Volltext nicht online. |
Neukum, G. and the GLL Imaging Team (1992) Gaspra's Cratering History. World Space Congress, COSPAR, Washington, DC, USA, 28 Aug. - 5 Sept. 1992. Volltext nicht online. |
Neukum, G. and the GLL Imaging Team (1992) Gaspra's Cratering Record. In: Implications for the Solar System Cratering History.. DPS-Conference, Munich, 12.-16.10.92. Volltext nicht online. |
Neukum, G. et al. (1992) The Galileo SSI Experiment at Gaspra. In: Lunar and Planetary Science Conference XXIII, Abstract VolumeOverview and expectations., pp. 83-84. Lunar and Planetary Institute, Houston. Lunar and Planetary Science Conference XXIII, Houston, 16.-20.3.92. Volltext nicht online. |
Neumann, A. (1992) Fernmessung von konzentrierter Solarstrahlung und Temperaturverteilungen an Receivern von Solarturmkraftwerken: Das Messystem HERMES II. In: Tagungsberichte des 8. Internationalen Sonnenforums, Berlin, 30.06. - 03.07.92., pp. 390-399. Volltext nicht online. |
Neumann, A. (1992) HERMES II, ein Heliostat- und Receiver-Mess-System. SOTA-Abschlußpräsentation, Köln, 10./11. Juni 1992. Volltext nicht online. |
Neumann, A. and Monterreal, R. (1992) Measurement of Concentrated Solar Radiation with thte HERMES II System at the PSA. 6th International Symposium on Solar Thermal Concentrating Technologies, Mojacar, Spanien, 28. Sept. - 02. Okt. 1992. Volltext nicht online. |
Neumann, A. and Schubnell, M. (1992) Einstellungs- und Sunshape-Messung fuer den Standort Koeln. In: Tagungsbericht des 8. Internationalen Sonnenforums, Berlin 30.06. - 03.07.92, 1173ff-. Volltext nicht online. |
Neumann, A. and Zimmermann, G. (1992) High Resolution Environment Spectrometer HIRES. Int. Workshop on EURECA Project LASFLEUR, Oberpfaffenhofen, April 1992.. Volltext nicht online. |
Niedbal, N. and Klusowski, E. (1992) Zur Wahl optimaler Erregerpunkte und -kraefte im Standschwingungsversuch. EMAUG / GESA-Treffen am 31.03.1992 und 01.04.1992 in Gaussig / Dresden.. Volltext nicht online. |
Niedbal, N. and Klusowski, E. (1992) Zur Transformation komplexer Eigenschwingungen in reelle. EMAUG / GESA-Treffen am 31.03. - 01.04.1992 in Gaussig / Dresden.. Volltext nicht online. |
Niederdrenk, P. (1992) Solution - Adaptive Grid Generation by Hyperbolic/Parabolized Hyperbolic P.D.E.S. In: 3rd International Conference on Numerical Grid GenerationNumerical Grid Generation in Computational Fluid Dynamics and Related Fields, pp. 173-184. North-Holland, Amsterdam, Holland. Volltext nicht online. |
Niederdrenk, P., M&u.ller, B., Sobieczky, H., (1992) Hypersonic Flow Simulation by Marching on an Adapting Grid. In: Notes on Numerical Methods in Fluid MechanicsNotes on Numerical Fluid Mechanics, pp. 481-490. Vieweg Verlag, Wiesbaden Deutschland. Volltext nicht online. |
Niederstadt, G. (1992) Einfuehrung in das Gebiet der Verbundwerkstoffe. Gesellschaft Deutscher Chemiker/Demozentrum,BS,Fortbildungsk.624/92 "Leichtbau mit Verbundwerkstoffen im Verkehrswesen", Braunschweig, 6.-7.10. 1992. Volltext nicht online. |
Niederstadt, G. (1992) Aufgaben und Ziele anhand beispielhafter Kooperationen. Einweihung des Neubaus fuer das Demonstrationszentrum f.Faserverbundwerkstoffe, DLR, Inst.f. Strukturmechanik,"Neue Werkstoffe-Neue Bauteilgestaltung", Braunschweig, 20.10. 1992.. Volltext nicht online. |
Niezgodka, A. and Henckels, A. and Weiland, C. (1) (1992) Pressure Measurements and Infrared Observation on the Windward Side of a Delta Wing. In: Proceedings of the Workshop on Hypersonic Flows for Reentry Problems, Part II; Held in Antibes, France; 15-19 April 1991, pp. 791-806. Springer-Verlag Berlin-Heidelberg; ISBN 3-540-56189-7. Proceedings of the Workshop on Hypersonic Flows for Reentry Problems, Part II; Held in Antibes, France; 15-19 April 1991. Volltext nicht online. |
Niezgodka, J. (1992) Modernization of Hypersonic Windtunnel H2Kin Cologne. 75th Semiannual STA Meeting, 29-30 April 1991, Austin/Texas. Volltext nicht online. |
Nithack, J. (1992) Anwendung von SAR-Daten fuer Landschaftsmonitoring. Vortrag, bei "Sommerschule des Muenchener Forschungsverbunds Fernerkundung", Geographisches Institut, Muenchen, 3.-7.8.92. Volltext nicht online. |
Nitsch, J. (1992) Erneuerbare Energiequellen und Rationelle Energieversorgung in Kommunen. In: Tagungsberichte Energieforum Pforzheim (Forum fuer Zunkunftsenergien Hrsg.) Pforzheim, 17.09.92. Volltext nicht online. |
Nitsch, J. (1992) Potentiale, Hemmnisse und Marktchancen erneuerbarer Energiequellen inBaden Wuerttemberg. Fachsymposium "Solarzeit in Baden Wuerttemberg", 26.09.92, Stuttgart. Volltext nicht online. |
Nitsch, J. (1992) Neue Koalitionen für eine dauerhafte Energiewirtschaft. Beitrag zum Jahrekongreß des Wissenschaftszentrums Nordrhein Westfalen "Umweltmanager und Umweltschützer im Dialog", 16. - 17.11.1992, Bonn Bad-Godesberg. Volltext nicht online. |
Nitsch, J. and Nast, M. (1992) Potential thermischer Solarenergienutzung. 2. Nationales Symposium "Thermische Solarenergienutzung", Kloster Ban z bei Staffelstein, 14./15. Mai 1992(Tag.-Ber.). Volltext nicht online. |
Nitzsche, F. (1) and Breitbach, E. (1992) The Smart Structures Technology in the Vibration Control of Helicopter Blades in forward Flight. EOS/SPIE and IOP Publishing Ltd 1992.. 1st European Conf. on Smart Structures and Materials, Glasgow, Scotland, May, 12-14, 1992.. Volltext nicht online. |
Nitzsche, F. (1) and Breitbach, E. (1992) A Study on the Feasibility of Using Adaptive Structures in the Attenuation of Vibration Characteristics of Rotary Wings. AIAA American Institute of Aeronautics and Astronautics, 370 L'Enfant Promenade, S.W., Washington, D.C. 20024.. 33rd AIAA/ASME/AHS/ASC Structures, Structural Dynamics and Materials Conference, April 13-15, 1992 / Dallas, TX.. Volltext nicht online. |
Nitzsche, F. (1) and Breitbach, E. (1992) Individaual Blade Control of Hinged Blades Using Smart Structures. Eighteenth European Rotorcraft Forum, Tenth European Helicopter Association Symposium and Helicopter Equipment Exhibit, Avignon September 15-18, 1992.. Volltext nicht online. |
Noack, Wolfgang and Schättler, Birgit and Wilhelms, Hartmut and Eineder, Michael (1992) The Operational ERS-1 SAR Processing System at the German PAF. IEEE, New York, USA. IGARSS '92, Houston, USA, May 25 - 29, 1992. Volltext nicht online. |
Nowack, H. and Trautmann, K.-H. and Marissen, R. and Schulte, K. and Peters, M. and Maldfeld, E. (1992) Fatigue Behaviour of 2090 and 8090 Double-Lug Specimens Simulating High Loaded Aircraft Components under Constant Amplitude and Flight-by-Flight Loading. In: Aluminium Lithium, M.Peters, P.-J.Winkler, Eds., pp. 651-656. DGM, Oberursel. Volltext nicht online. |
Nurtjahjo, A. and Ott, W. and Marissen, R. and Trautmann, K.-H. and Nowack, H. (1992) Comparison of the prediction capability of crack initiation life prediction methods for biaxial loading conditions. In: Proc. (1992) pp. 317-324, pp. 317-324. Elsevier Science Publishers LTD, England. Third International Conference on Low Cycle Fatigue and Elasto-Plastic Behaviour of Materials, LCF 3, Berlin, September 7-11,1992. Volltext nicht online. |
O
Oehler, A. and Dummel, A. and Rebhan, H. and Neukum, G. (1992) Goniospectrophotometric laboratory experiments in the UV, VIS and NIRas a tool for the interpretation of photometric remote sensing data. San Juan Capistrano Research Institute. Infrared Spectroscopy of Surfaces Conference, San Juan Capistrano, 3.-6.8.92. Volltext nicht online. |
Oehler, A. and Neukum, G. (1992) First results from the DLR-Goniospectrophotometer. 23rd Lunar and Planetary Science Conference, Houston, 16.3.-20.3.92. Volltext nicht online. |
Oertel, C.-H. and Gelhaar, B. (1992) A Fast Realtime Simulation of a Complex Mechanical System on a Parallel Hardware Architecture. In: Proceedings of the International Telemetering Conference, San Diego, CA, USA, 22 - 28 October 1992, pp. 441-448. Volltext nicht online. |
Oertel, D. and Reulke, R. and Sandau, R. and Scheele, M. and Terzibaschian, T. (1992) A Flexible Digital Wide-Angle Optoelectronic Stereo Scanner. In: Proc. XVII Congress International Society for Photogrammetry and Remote Sensing (1992) 6 p.. Volltext nicht online. |
Oettl, H. (1992) Case Study: X-SAR. Die 44 Viewgraphs wurden von CNR-IRECE kopiert und in gebundener Form an die Tagungsteilnehmer verteilt.. Imaging Radar: Mission, Technology and Applications, June 15-19, 1992, Capri; organized by CNR-IRECE, Neapel, Italy and JPL, USA. Volltext nicht online. |
Oettl, H. (1992) Radiometric Calibration of SAR Systems. Vortrag, gehalten auf: AGARD Lecture Series 182 'Fundamentals and Special Problems of Synthetic Aperture Radar (SAR)', Bad Neuenahr, 5.-6.10.92, Germany, Gebze-Kocaeli, 8.-9.10.92, Turkey, Ottawa, 26.-27.10.92, Canada; Proc. AGARD-LS-182. Volltext nicht online. |
Oettl, H. (1992) The Real Aperture Antenna of SAR, a Key Element for Performance. Vortrag, gehalten auf: AGARD Lecture Series 182 'Fundamentals and Special Problems of Synthetic Aperture Radar (SAR)', Bad Neuenahr, 5.-6.10.92, Germany; Gebye-Kocaeli, 8.-9.10.92, Turkey; Ottawa, 26.-27.10.92, Canada; Proc. AGARD-LS-182. Volltext nicht online. |
Oettl, H. (1992) Radiometric Calibration of the Data Products. Vortrag, gehalten auf: SIR-C/X-SAR Team Meeting, JPL, Pasadena (USA), 15.-18.11.92. Volltext nicht online. |
Oettl, H. (1992) Introduction in Spaceborne Active Microwave Remote Sensing. Vortrag, gehalten auf: 18th Symposium on Space Technology and Science (ISTS), Kagoshima, Japan, 17.-22.5.92 (20 Viewgraphs).. Volltext nicht online. |
Oettl, H. and Zink, M. (Vortragender), Zeller, K.H., Freeman, A. *) *) JPL, Pasadena, USA, (1992) Design of a Monopulse SAR System to Determine Elevation Angles. IEEE, Piscataway, N.J.. Vortrag, gehalten auf: IGARSS '92, Houston, Texas, USA, 26.-29.5.92 Proc. IEEE Cat.Nr. 92 CH 3041-1, 1992, Vol. I. Volltext nicht online. |
Oettl, H. (Vortragender) Wahl, M. 1), (1992) X-EOS, a Multi-Mode X-Band Synthetic Aperture Radar for EOS SAR. Vorgetragen, auf European 'International Space Year' Conference 1992, Munich, 30.3.-4.4.92 Proc. of the Central Symp. of the 'Internat. Space Year" Conf. ESA SP-341, July 92. Volltext nicht online. |
Oettl, H. (Vortragender), Bloetscher, H., Kietzmann, H., (1992) Antennendiagrammvermessung grosser Flugzeug- und Satelliten-Radarantennen. Vortrag, gehalten auf: Fachausschuss "Antennen" der ITG im VDE, Bad Duerkheim, 1.-2.4.92 Proceedings Mehrelementeantennen, Bad Duerkheim. Volltext nicht online. |
Oser, H. and Stothard, N. and Humpfer, R. and Grotheer, H.H. (1992) Die Radikal-Radikal-Reaktion CH3+OH -> Produkte. Internes TECFLAM-Seminar, Karlsruhe, April 1991.. Volltext nicht online. |
Oser, H. and Stothard, N. and Humpfer, R. and Grotheer, H.H. and Just, Th. (1992) Direct Measurement of the Reaction CH3+OH and its Pathways between 300 and 480 K. In: Proc. 24th Int. Symp. on Combustion (1992), pp. 597-604. 24th International Symposium on Combustion, Sydney, 5-10 July 1992. Volltext nicht online. |
Oser, H. and Stothard, N.D. and Humpfer, R. and Grotheer, H.H. and Just, Th. (1992) Direct Investigation of the Kinetics and Mechanism of the CH3+OH Reaction between 300 and 480 K. 12th Int. Symposium on Gas Kinetics, Reading, UK, July 1992. Volltext nicht online. |
P
Pagendarm, H.-G. (1992) Auswertung von Numerischen Stroemungssimulationen mittels Computergrafik unter Verwendung des Softwaresystems HIGHEND. DGLR-Jahrestagung, Bremen 29. Sept. - 2. Okt. 1992. Volltext nicht online. |
Pagendarm, H.-G. (1992) Interactive Visualization of Fluid Dynamics Data Using the Visualization System HIGHEND. ERCOFTAC Workshop on 'Visualization of Numerically Generated Data' Rutherford Appleton Baboratory, Oxfordshire, UK, 15-19 Juni, 1992. Volltext nicht online. |
Pagendarm, H.-G. (1992) Visualisierung von 3D-Daten auf Sun Workstation. Technical Meeting und Mitgliederversammlung der Sun User Group Deutschland, Universitaet Paderborn, 2.04.1992. Volltext nicht online. |
Pagendarm, H.-G. (1992) Computereinsatz in der DLR am Beispiel des Forschungszentrums Goettingen. Vortrag am 27.11.1992 in Goettingen. Volltext nicht online. |
Pagendarm, H.-G. (1992) Flow Visualization from Numerical Data. Lecture at the University of Warwick, Computer Science, June 23, 1992. Volltext nicht online. |
Pagendarm, H.-G. (1992) Visualization of Large Numerical Data Sets from Flow Simulation. Lecture in the Course on Principles of Visualization in Fluid Mechanics, J.M. Burgers Centre for Fluid Mechanics, Delft University of Technology, August 24-28, 1992. Volltext nicht online. |
Pagendarm, H.-G., Seitz, B., (1992) An Algorithm for Detection and Visualization of Discontinuities in Scientific Data Fields Applied to Flow Data with Shock Waves. III. Eurographics Workshop in Visualization in Scientific Computing, Viareggio, Italy, 27.-29. April 1992. Volltext nicht online. |
Pak, H. and Krain, H. (1992) Zischenbericht ueber Vorhaben Nr. 493 Radialverdichter hoher Schluckfaehigkeit. Informationstagung Turbinen des FVV e.V. am k01.04.92 in Lahnstein. Volltext nicht online. |
Pak, H. (1992) Stand der Neuauslegung des Laufrades SRV2. FVV-Arbeitskreissitzung "Radialverdichter hoher Schluckfaehigkeit", 05.02.1992, Oberursel. Volltext nicht online. |
Pak, H. (1992) Vorstellung eines Geometrieentwurfs fuer das neue Laufrad SRV2. FVV-Arbeitskreissitzung "Radialverdichter hoher Schluckfaehigkeit", 18.03.1992, Koeln-Porz. Volltext nicht online. |
Pak, H. (1992) Beschreibung des neuen Laufrades SRV2 und vergleichende Untersuchungen der transsonischen Anstroemung fuer den SRV1 und SRV2. FVV-Arbeitskreissitzung "Radialverdichter hoher Schluckfaehigkeit", 16.09.1992 , Zürich, Schweiz. Volltext nicht online. |
Panaras, A.G. (Vortragender), Vollmers, H., M&u.ller, B., (1992) Simulation of Laminar Hypersonic Flow About a Longitudinal Corner. INRIA, Antibes, France, 1991. Workshop on Hypersonic Flows for Reentry Problems, Part II., Antibes, France, April 15-19, 1991. Volltext nicht online. |
Panula-Ontto, E. (1992) Oscillator Phase Noise and SAR Image Quality. Wissenschaftliches Kolloquium, DLR, NE-HF, Oberpfaffenhofen, 10.12.1992.. Volltext nicht online. |
Panzner, G. (1992) Die Projekttraegerschaft Umweltschutztechnik und ihre Aufgabe als Kontaktstelle fuer das EG-Umweltforschungsprogramm. Symposium über Europäische Forschungskooperation im Bereich der Umwelttechnologien; sterreichisches Sekretariat für EG-Forschungsund Technologieprogramme und EUREKA, Wien, 28. Januar 1992.. Volltext nicht online. |
Panzner, G. (1992) The Closing of Substance Cycles Low-emission Processes and Products: Actual Research Topics in BMFT Programme Research and Technology, 1989-1994. Int. Workshop on Sustainable Development, TNO Centre for Technology and Policy Studies, Lisse, The Netherlands, 3 February 1992.. Volltext nicht online. |
Panzner, G. (1992) EG-Umweltforschungsprogramm 1991-1994. Informationsveranstaltung bei ERIC, Berlin, 5. Mai 1992.. Volltext nicht online. |
Panzner, G. (1992) Environmental Technology in the 6th CEC Environmental Research Programme (1991-1994). Vortrag bei Zenith GmbH, Mülheim a.d. Ruhr, 9. Juni 1992.. Volltext nicht online. |
Pappa, R. S. (1) and Elliott, K. B. (1) and Schenk, A. (1992) A Consistent-Mode Indicator for the Eigensystem Realization Algorithm. AIAA Washington, D.C., USA.. AIAA Dynamics Specialists Conference, April 16-17, 1992, Dallas, TX, USA, AIAA Paper No. 92-2136.. Volltext nicht online. |
Paul, K.(1) and Rott, M.(1) and Igenbergs, E.(1) and Hamacher, H. (1992) Studies on impact features on Germanium targets of experiment A0187-2 and their experimental simulation. LDEF Materials Resuls for Spacecraft Applications Conference. Huntsville, AL, Oct. 27.-28.1992. Volltext nicht online. |
Pausder, H.-J. and Blanken, C. L. (1) (1992) Generation of Helicopter Roll Axis Bandwidth Data through Ground-Based and In-Flight Simulation. In: AGARD-CP 519 "Flight Testing". Flight Mechanics Panel Symposium "Flight Testing", Chania, Crete, Greece, 11 - 14 May 1992. Volltext nicht online. |
Pausder, H.-J. and Blanken, C. L. (1) (1992) Investigation of the Effects of Bandwidth and Time Delay on Helicopter Roll-Axis Handling Qualities. In: Proceedings of the 18th European Rotorcraft Forum, Avignon, France, 15 - 18 September 1992. Volltext nicht online. |
Pausder, H.-J. and Bouwer, G. and Grünhagen, W. von and Holland, R. (1992) Helicopter In-Flight Simulator ATTHeS. A Multipurpose Testbed and its Utilization. In: Proceedings of the AIAA/AHS Flight Simulation Techn. Conf. 1992, AIAA-Paper 92-4173. AIAA/AHS Flight Simulation Technologies Conference, Hilton Head Island, SC, USA, 24 - 26 August 1992. Volltext nicht online. |
Pawlitzek, G. and Mikusch, E. (1992) Seminar Software Engineering. Carl-Cranz-Gresellschaft, OP. Seminar IT 3.26 der Carl-Cranz-Gesellschaft, Oberpfaffenhofen, 7.-10.12.1992. Volltext nicht online. |
Pawlitzek, G. and Mikusch, E. and Wildegger, W. (1992) Einführung von Software Engineering Techniken, Methoden und Werkzeugen in größere Software Projekte. Institutskolloquium am Inst. f. Computerwissenschaften und Systemanalyse der Universität Salzburg, 21.01.1992. Volltext nicht online. |
Pawson, S.(Vortragender,*), and Dameris, M. (*) Inst. f. Meteorologie, Freie Univ. Berlin, (1992) Modelling the Effects of Solar Variability on the Middle Atmosphere: A review. European Geophysical Society (EGS), 6.-10.4.92, Edinburgh, UK. Volltext nicht online. |
Perkins, M.G. (1992) Data Compression of Stereopairs. In: IEEE Trans. on Comm., April 1992, 40, No. 4, pp. 684-696. Volltext nicht online. |
Peters, M. (1992) Light-Metal Activities at DLR. Air-Force Materials Laboratory, Dayton, OH, USA, 26. Juni 1992. Volltext nicht online. |
Peters, M. (1992) Room and Elevated Temperature Properties of Ti-1100. 7th World Conference on Titanium, San Diego, CA, USA 30. Juni 1992. Volltext nicht online. |
Peters, M. (1992) Titanlegierungen in der Luft- und Raumfahrt. DGM-Hauptversammlung, Hamburg, 10. Juni 1992. Volltext nicht online. |
Peters, M. (1992) Schutzschichtentwicklung von Ti-Legierungen. DGM-Fachausschußsitzung "Titan", München, 21.Okotber 1992. Volltext nicht online. |
Peters, M. (1992) Leichtmetalle in der Luft- und Raumfahrt. DLR-Werkstoffkolloquium, 10. Dezember 1992. Volltext nicht online. |
Peters, M. and P.-J. Winkler (Eds.), (1992) Aluminium Lithium. In: Aluminium Lithium, Vol. 1 + 2, Winkler, P.-J., Ed., pp. 1-1420. DGM, Oberursel. Volltext nicht online. |
Peters, M. and Winkler, P.-J. (1992) Leichtmetalle in der Luft- und Raumfahrt I. In: Metall 46 (12/1992), pp. 1226-1234. Volltext nicht online. |
Peters, P.W.M. and Albertsen, H. (1992) Einfluss der Faserbehandlung auf die Faser/Matrix Haftung und auf die mechanischen Eigenschaften von CFK. In: Symposium Verbundwerkstoffe und Werkstoffverbunde 17-19 Juni 1992, Chemnitz. Volltext nicht online. |
Pflug, B. (1992) Zum Informationsgehalt spektraler Strahldichtemessungen in den roten O2-Banden der Atmosphaere. Seminarvortrag im Institut für Meteorologie der Humboldt-Universität Berlin am 16. Dezember 1992.. Volltext nicht online. |
Pflug, B. and Piesik, B. and Zimmermann, G. (1992) Can Measurements in the O2A- and B-Bands be Used for Atmospheric Correction of Satellite Measurements Over the Ocean? In: Proc. of the Central Symposium of the International Space Year Conference, ESA SP-341 (1992) pp. 65-68, pp. 65-68. ESA. Central Symposium of the International Space Year Conference, Munich, 30 March-4 April 1992. Volltext nicht online. |
Piening, M. (1992) Balken mit Biege-Torsionskopplung. Carl-Cranz-Ges. CCG, Lehrgang BW 2.02, "Strukturmechanische Berechnung im Leichtbau mit Faserverbundwerkstoffen" , Braunschweig, 11.5.-15.5.1992.. Volltext nicht online. |
Piesik, B. (1992) Aerosol Research including MOS System on PRIRODA Module. NASA's Earth Science and Application Division "Global Aerosols and Ocean Biochemistry Workshop", Orlando, FLA, 1-3 September 1992. Volltext nicht online. |
Piesik, B. and Pflug, B. (1992) Bestimmung von Aerosolparametern aus multispektralen Strahldichtemessungen im NIR und in der O2A-Bande. DFG-Kolloquium "Physikalische Methoden der Fernerkundung von Atmosphäre ind Hydrosphäre", Hamburg, 27.-28. April 1992.. Volltext nicht online. |
Pieters, C.M.(1) and Belton, M.(2) and Fischer, E.(3) and Greeley, R.(4) and Jaumann, R. and Head, J.W.(1) and Hoffmann, H. and McEwen, A.(5) and Murchie, S. (1) and Neukum, G. and Sunshine, J.(1) (1992) Compositional implications of SSI multispectral images of the unexplores lunar farside. In: Lunar and Planteray Science Conference XXIII Abstract Volume, pp. 1069-1070. Lunar and Planetary Institute, Houston, USA. Volltext nicht online. |
Plath, I. and Meier, U. and Kohse-Höinghaus, K. (1992) 2D-Laserdiagnostik in Stuttgart. DLR-Kolloquium LIF 5, Lampoldshausen, 1992. Volltext nicht online. |
Plath, I. and Meier, V. and Kohse-Höinghaus, K. and Attal-Tretout, B. (1992) DFWM Experiments for NO Combustion Diagnosis. In: Proc. XI European CARS Workshop (1992). World Scientific Publishing Co., Ltd., Singapore. XI European CARS Workshop, Florence, 23-25 March 1992. Volltext nicht online. |
Plath, I. and Meier, W. and Stricker, W. (1992) Application of an Unintensified CCD Camera for Single-Pulse CARS Thermometry. 11th European CARS Workshop, Florence, Italy, 1992.. Volltext nicht online. |
Pleger, R. and Braue, W. (1992) On the Structural Variety of Carbon in C/C Composites by Means of TEM and Digital Image Processing. In: 5th International Carbon Conference, 22.-26.06.1992, Essen, pp. 653-655. Volltext nicht online. |
Ploetz, F. and Funken, K.-H. (1992) Bewertung solarchemischer Verfahren. 7. Sitz. d. Schwerp. Solare Chemie u. Solare Materialuntersuchung der AG Solar NRW Muelheim/Ruhr, 14.10.92. Volltext nicht online. |
Ponater, M. and Schubert, S.(1) (1992) External and Internal Extratropical Atmospheric Variability Patterns. In: Annales Geophysicae, Supplement II, 10. 17. EGS General Assembly, Edinburgh, UK, 6.-10.4.92. Volltext nicht online. |
Ponater, M.(Vortragender) and Santer, B.D.(1) and Schubert, S. (2) (1) Lawrence Livermore National Laboratory,CO, USA, (1992) On the Sensitivity of Extratropical Variability Patterns to Interannual Sea Surface Temperature Fluctuations. In: Proc. 2. Intern. Conf. on modelling of global climate change and variability. 2. Intern. Conf. on Modelling of Global Change and Variability, Hamburg, 7.-11.9.92. Volltext nicht online. |
Porsche, H. (1992) Doppler-Frequenz-Messung zur Bestimmung der Geschwindigkeitsaenderung beim Flug von Giotto durch den Kometen Halley. Vortrag, gehalten auf: URSI-Tagung, Kleinheubach, 10.10.91 Proc.: Kleinheubacher Berichte ISSN 0343-5725. Volltext nicht online. |
Prinz, R. (1992) Schadensmechanische Grundlagen und Schwingfestigkeit. Carl-Cranz-Ges. CCG, Lehrgang BW 2.02, "Strukturmechanische Berechnung im Leichtbau mit Faserverbundwerkstoffen", Braunschweig, 11.5.-15.5. 1992.. Volltext nicht online. |
Prinz, R. (1992) Der Einfluss von Delaminationen auf das Versagen von Faserverbund-Laminaten bei betriebsnaher Belastung. Deutsche Gesellschaft fuer Materialkunde e.V. 7. Sitzung des GGM Fachausschusses "Gefuege und Eigenschaften von Polymerwerkstoffen". Deutsche Airbus, Bremen, 23.11.1992.. Volltext nicht online. |
Prinz, R. (1992) Schwingfestigkeit und Schaedigungsmechanismen von CFK. Universitaet GH-Duisburg, Fachbereich Maschinenbau, Fachgebiet Werkstofftechnik, Duisburg, 30.11. 1992.. Volltext nicht online. |
Prucker, S. and Meier, W. and Plath, I. and Stricker, W. (1992) Raman-Einzelpulsmessungen in turbulenten Flammen. DLR-Kolloquium LIF 5, Lampoldshausen, 1992.. Volltext nicht online. |
Prucker, S. and Meier, W. and Stricker, W. (1992) Temperatur- und Konzentrationsmessung in einer turbulenten H2/Luft-Diffusionsflamme mit Raman-Einzelpuls-Spektroskopie. TECFLAM-Seminar, Darmstadt, 1992. Volltext nicht online. |
Q
Quante, M.(1) and Baumann, R. and Brown, P.R.A.(2) and Busen, R. and Guillemet, B.(3) (1992) Three-Aircraft Intercomparison of Wind and Turbulence Measurements during PRE-EUCREX Campaign. In: Report of: Fifth ICE/EUCREX Workshop, Clermont-Ferrand, France, June 1-4, 1992, pp. 71-75. Volltext nicht online. |
Quinn, G.D. and Braue, W. (1992) Devitrification of Sintered Silicon Nitride During Static Fatigue Testing. 94th Annual Meeting of the American Ceramic Society, Minneapolis, USA, 12.-16.04.1992. Volltext nicht online. |
R
R. Fuchs, H.A. Schreiber (1992) Entwicklung einer Entwurfsmethode fuer transsonische Axialverdichter-gitter-Vorstellung des Vorhabens. Vortrag 4. Arbeitskreissitzung AG-Tubo-Turbotech, 16.-17.03.92 in Koeln-Porz. Volltext nicht online. |
R. Schodl, (1992) Triebwerksmetechnik - Aufgaben, Struktur, Kooperationen, Ergebnisse. DLR-SM-AT-Seminar, Mai 1992. Volltext nicht online. |
R. Schodl, (1992) Neue Entwicklungen beim L2F-Verfahren. Workshop: "Lasermethoden in der Stroemungsmeßtechnik", 29.-30.09.92 in Karlsruhe. Volltext nicht online. |
R. Schodl, (1992) Development of 3D-Velocimeters based on the Laser2-Focus Technique. 11th Symposium on "Measuring Techniques for Transonic and Supersonic Flow in Cascades and Turbomachines", 14.-15.09.92, Muenchen. Volltext nicht online. |
R. Volz, (1992) Producing Hardfacing Layers on Aluminum Alloys with High Power CO2 Lasers. In: Proceedings of ECLAT 1992 (European Conference on Laser Treatment of Materials), pp. 399-404. DGM Informationsgesellschaft - Verlag. Volltext nicht online. |
R. Volz, (1992) Production of Load Bearing and Hardfacing Layers on Aluminum Alloys with the CO2 Laser. ICALEO 92, Orlando, FLa, USA, 26.-29.10.1992. Volltext nicht online. |
R. Volz, (1992) Cladding/Alloying of Selffluxing Alloying Powders on Aluminum Substrates by CO2 Lasers. EAST-Kongress, 12.-13.11.1992, Schwaebisch Gmuend. Volltext nicht online. |
Radespiel, R. (1992) Navier-Stokes Solver as a Tool for the Aerothermodynamics Design for Hypersonic Vehicles. EUROMECH 289 Colloquium on "Hypersonic Aerodynamics", 6.-8. April 1992, Aachen, Germany. Volltext nicht online. |
Radespiel, R. (1992) Multigrid Method with Upwind Spatial Discretisations. 25th Anniversary INRIA, Paris, December 8th-11th, 1992. Volltext nicht online. |
Radespiel, R. and Kroll, N. (1992) Extension of the Navier-Stokes Code CEVCATS to Hypersonic Equilibrium Flows. DLR. Volltext nicht online. |
Raffel, M. and Vogt, A. and Kompenhans, J. (1992) Messung des instationären Geschwindigkeitsfeldes an einem NACA 0012 Profil mit Hilfe der Particle Image Velocimetry. 8. DGLR-Fach-Symp. "Strömungen mit Ablösung", 10.-12.11.1992, DLR, Köln-Porz. Volltext nicht online. |
Rahm, S. (1992) Capability of an Optical Detector Preamplifier in a CO Doppler-Lidar. 1st Workshop on Optical Amplifiers for Lidar Applications, Nov. 12-13, 1992, Great Malvern, U.K.. Volltext nicht online. |
Rahm, S. (1992) Optischer Verstrker. DLR-Kolloquium über Lidar, Oberpfaffenhofen Nov. 24, 1992. Volltext nicht online. |
Rapp, CH. (1992) Kohaerent-optische Experimentalsysteme fuer die Freiraumkommunikation. 10. Intern. Mittweidaer Fachtagung, Tagungsgruppe A: Telekommunikation, 15.-17.9.92 in Mittweida/Sachsen. Volltext nicht online. |
Rapp, Ch. (1992) Optische Weltraumkommunikation - Stand der Arbeiten am Institut fuer Nachrichten der DLR. HHI-Kolloquien 1992, Heinrich-Hertz-Institut fuer Nachrichtentechnik, Berlin GmbH, am 8.9.1992 in Berlin. Volltext nicht online. |
Ratke, L. and Diefenbach, S. and Prinz, B. and Ahlborn, H. and Feuerbacher, B. (1992) Marangoni motion during melting of a hypermonotectic alloy numerical simulations for the D2 Experiment IHF 04. VIII European Symp. Materials and Fluid Sciences under Microgravity, 1992, Brussels. Volltext nicht online. |
Redeker, G. (1992) Progress in Laminar Flow Wing Design. In: Proceedings "Espacio 21 II Congreco INTA", pp. 23-33. INTA, Madrid, Spanien. Espacio 21, Madrid, 26.-29.10.1992. Volltext nicht online. |
Redeker, G. (1992) Fortschritte beim Entwurf von Laminarfluegeln. Kolloquium am Institut fuer Luftfahrttechnik und Leichtbau, Universitaet der Bundeswehr, Muenchen, 8.12.1992. Volltext nicht online. |
Redeker, G. and Mueller, R. and Blanchard, A. and Reneaux, J. (1992) Evaluation of Transonic Laminar Airfoil Tests under Cryogenic Conditions Including Stability Analysis and Computational Results. In: DGLR/AAAF/RAeS Proceedings First European Forum on Laminar Flow Technologz, pp. 141-151. DGLR. Volltext nicht online. |
Redeker, G. and Quast, A. (1992) Das A 320 Laminar-Seitenleitwerks-Programm. In: DGLR. DGLR, Bonn. 8. DGLR-Fach-Symposium Stroemungen mit Abloesung, Koeln-Porz, 10.-12.11.1992. Volltext nicht online. |
Redeker, G,, and Quast, A. and Thibert, J. J. (1992) Das A320 Laminar-Seitenleitwerks-Programm. DGLR, Bonn. DGLR-Jahrestagung, Bremen, 29.9-2.10.1992. Volltext nicht online. |
Reichert, M. (1992) Conditions for Economic Benefit by Using Lunar Oxygen for Earth-Moon Transportation Systems. ISU 1992 in Kitakyushu, Japan am 14.08.92. Volltext nicht online. |
Reichert, M. (1992) Conditions for economic benefit by using lunar oxygen for Earth-Moon-Transportation Systems. Boeing Defense & Space Group, Huntsville, AL, USA am 21.09.92. Volltext nicht online. |
Reichert, M. (1992) Die International Space University. Gehalten bei DARA am 03.12.92. Volltext nicht online. |
Reigber, Ch. and Zhu, S.Y. and Galas, R. and Riszos, Ch. (1992) Strategies for GPS Orbit Determination in Dogs. The Sixth Symposium on Satellite Positioning , March 17 - 20, 1992, Columbus, USA . Volltext nicht online. |
Reigber, Christoph and Markwitz, W. and Angermann, D. and Dick, G. and Galas, R. and Nischan, Th. and Sommerfeld, W. and Zhu, S.Y. (1992) Orbit and Geodetic Parameter Estimations from global GPS Data. XXVIX COSPAR Planetary Meeting, World Space Congress, Washington D.C./USA, August 28 - Sept. 9, 1992. Volltext nicht online. |
Reimer, R. (1992) Beiträge der Fernerkundungsstation Neustrelitz als Außenstelle der deutschen Großforschungseinrichtung für Luft- und Raumfahrt. Urania-Veranstaltung am 30.06.1992, Neubrandenburg. Volltext nicht online. |
Reimer, R. (1992) Beiträge der Fernerkundungsstation Neustrelitz als Auenstelle der DLR. Projektwoche 9./10. Klasse am 21.12.1992 in Neustrelitz. Volltext nicht online. |
Reinartz, Peter (1992) Classification of Forest Damage in Germany with Airborne Multispectral Data. In: Proceedings of the international conf. on Airborne Multispectral Scanning for Forestry and Mapping, 1. Forestry, Canada, Chalk River, Canada. Vortrag in Kanada am 15.04.92. Volltext nicht online. |
Reinartz, Peter and Müller, Rupert and Kritikos, Georg (1992) Classification of Forest Damages in Germany with Airborne Multispectral Data. In: Conf. Proc. OWLS: "Optics for Protect. of Man and Environment against Natural and Technologic. Disasters", 1. Elsevier Science Publishers, Amsterdam, Holland. Münster am 08.10.92. Volltext nicht online. |
Reiniger, K.-D. and Zimmer, A. and Dech, S. (1992) Die Deutsche Satellitenbodenstation in der Antarktis Realisierung und erste Ergebnisse. In: Tagungsband des 8. Nutzerseminars des Deutschen Fernerkundungsdatenzentrums in Oberpfaffenhofen, pp. 40-45. Volltext nicht online. |
Reitz, G. (1992) Space Radiation Dosimetry. In: Acta Astronautica. Pergamon Press plc, London, G.B.. Volltext nicht online. |
Reitz, G. (1992) Preliminary Total Dose Measurements on LDEF. In: Adv. Space Res., No. 2-3, No.2-3-. Pergamon Press plc, Oxford, U.K.. Volltext nicht online. |
Renger, W. (1992) LIDAR-Measurements During EASOE 91/92 Using Airborne LIDAR OLEX of DLR. Workshop AEROSOL/PSC, L'Aquila, Italien, 29.5.92. Volltext nicht online. |
Renger, W. (1992) Untersuchung der arktischen Stratosphaere mittels eines flugzeuggetragenen LIDAR-Systems. Meteorol. Koll., Univ. München, 2.6.92. Volltext nicht online. |
Renger, W. (1992) Sondierung der arktischen Stratosphaere mit dem Flugzeug LIDAR OLEX. Inst.koll., Inst. f. Meteorologie u. Klimaforschung, Karlsruhe, 9.6.92. Volltext nicht online. |
Renger, W. (1992) Ozon-LIDAR-Messungen von der Transall. 2. Statusseminar des Ozonforschungsprogramms des BMFT, Bonn-Bad Godesberg, 25.-27.6.92. Volltext nicht online. |
Renger, W. (Vortragender) and Ehret, G. and Mörl, P. and Wirth, M. (1992) Airborne Lidar Measurements of Stratospheric Aerosols during the European Arctic Stratospheric Ozone Experiment (EASOE). In: Proc. 16th International Laser Radar Conference, Cambridge, Mass., USA, 20-24 July, 1992, pp. 289-290. 16th International Laser Radar Conference, Cambridge, Mass., USA, 20-24 July 1992. Volltext nicht online. |
Renger, W. (Vortragender) and Ehret, G. and Wirth, M. (1992) Ozon-LIDAR-Messungen von der Transall. In: Proc. 2. Statusseminar des Ozonforschungsprogramms (OFP) des BMFT, Bonn, 25.-27.6.1992, pp. 111-115. Volltext nicht online. |
Renger. W. (Vortragender), and Ehret, G. and Wirth, M. (1992) LIDAR-Aerosolmessungen von der Transall. In: Proc. 2. Statusseminar des OFP des BMFT, Bonn, 25.-27.6.1992, pp. 41-46. 2. Statusseminar des OFP des BMFT, Bonn, 26.-27.6.1992. Volltext nicht online. |
Renz, G. and Spindler, G. (1992) The Stuttgart Raman Free Electron Laser - Project: Theoretical and Experimental Results. In: Proceedings (1992)., pp. 56-57. SPIE, USA. Volltext nicht online. |
Renz, G. and Spindler, G. (1992) Effect of electron dynamics on spontaneous emission spectra in free electron lasers. In: Proceedings Vol. A318 (1992) NuclearInstruments and Methods in Physics Research, Section A, pp. 669-674. North Holland, Niederlande. Volltext nicht online. |
Reulke, R. and Scheele, M. and Terzibaschian, T. (1992) Ein CCD-Zeilenscanner mit Stereomoeglichkeiten, Testaufnahmen und Auswertung. Seminar zu theoretischen Grundlagen der Bildverarbeitung, Buckow, 30. März-3. April 1992.. Volltext nicht online. |
Riede, W. and Hall, Th. and Klingenberg, H.H. (1992) Einfluss der Kohaerenz auf die Effizienz der Vierwellenmischung mit CO2-Lasern. Verh. der DPG (Frühjahrstagung der Deutschen Physikalischen Gesellschaft) Vortrag Q 30.8, Hannover 1992. Volltext nicht online. |
Riedelbauch, S. (1992) Numerical Simulation of Laminar Hypersonic Flow Past a Double Ellipsoid. In: Workshop on Hypersonic Flows for Reentry Problems, pp. 517-534. Springer Verlag. Volltext nicht online. |
Ringel, G. and Schmitt, D.-R. (1992) Optische Rauhigkeitsmessung an superglatten Oberflaechen. Jahrestagung der Deutschen Gesellschaft fuer angewandte Optik, Friedrichroda, 9.-13.6.92. Volltext nicht online. |
Rinke, S. (1992) Arbeit und Technik bei der Fabrikinnovation. In: Förderung neue Bundesländer.. DGB Jena, IGM Frankfurt und Verein zur Förderung von Forschung , Innovation und Technologie für die Strukturentwicklung e.V., Jena, 23. November 1992.. Volltext nicht online. |
Robertson, P. (1992) A Generalized Frame Synchronizer. In: IEEE GLOBECOM'92, 1992 Conf. Record, Vol. 1 of 3, pp. 365-369. IEEE Global Telecommunications Conference, 6.-9.12.1992 in Orlando, Florida, USA.. Volltext nicht online. |
Robertson, P. (1992) Maximum Likelihood Frame Synchronization for Flat Fading Channels. In: Proc. of the Intern. Conf. on Comm. (ICC'92), Chicago/USA,, pp. 1426-1430. ICC'92, Chicago/USA, 14.-18.6.1992. Volltext nicht online. |
Rodloff, R. and Wetzig, V. and Luebeck, E. and Burchard, W. and Jungbluth, W. (1992) Lasergyro - the next Generation. DGON Proc. Symposium Gyro Technology, Stuttgart, 20.09.92. Volltext nicht online. |
Roehle, I. and Schodl, R. (1992) Untersuchungen zur Ermittlung des Genauigkeitspotentials der Doppler Global Mehtode zur 2D-Geschwindigkeitsanalyse. DLR-SM-AT-Seminar , 1992, Göttingen. Volltext nicht online. |
Roehr, W. (1992) Entwurf und Realisierung eines optisch-kohaerenten DPSK-Uebertragungssystems fuer ein Freiraumexperiment an der DLR. Institutskolloquium von NT am 26.2.1992. Volltext nicht online. |
Rohlf, D. (1992) Parameter Identification: Approach and Results (Aerodynamics and Thrust Vectoring). In: NASA-CP-3137, Vol. 1, pp. 213-224. NASA High-Angle-of-Attack Projects and Technology Conference, Dryden Flight Research Facility, Edwards, CA, USA, 21 - 23 April 1992. Volltext nicht online. |
Rohwer, K. (1992) Improved transverse shear stiffnesses for anisotropic sandwich plates and shells. In: International Conference on Sandwich Construction., Vol.1. 2nd International Conference on Sandwich Construction, Gainesville, Florida, USA, 9.-12.3. 1992.. Volltext nicht online. |
Rohwer, K. (1992) Querschubsteifigkeiten zur Berechnung anisotroper Sandwichstrukturen. Institutskolloquium, Braunschweig, 28.2. 1992.. Volltext nicht online. |
Rohwer, K. (1992) Ueberblick ueber Platten- und Schalentheorie. Carl-Cranz-Ges. CCG, Lehrgang BW 2.02, "Strukturmechanische Berechnung im Leichtbau mit Faserverbundwerkstoffen", Braunschweig, 11.5.-15.5.1992.. Volltext nicht online. |
Rohwer, K. (1992) Erweiterungen der Schichtentheorie: Interlaminare Schubspannungen und Querschubsteifigkeit. Carl-Cranz-Ges. CCG, Lehrgang BW 2.02, "Strukturmechanische Berechnung im Leichtbau mit Faserverbundwerkstoffen", Braunschweig, 11.5.-15.5.1992.. Volltext nicht online. |
Rohwer, K. (1992) Ueberblick ueber Rechenprogramme. Carl-Cranz-Ges. CCG, Lehrgang BW 2.02, "Strukturmechanische Berechnung im Leichtbau mit Faserverbundwerkstoffen", Braunschweig, 11.5.-15.5.1992.. Volltext nicht online. |
Rohwer, K. (1992) Einfluss der Anisotropie auf die Beullasten. Carl-Cranz-Ges. CCG, Lehrgang BW 2.02, "Strukturmechanische Berechnung im Leichtbau mit Faserverbundwerkstoffen", Braunschweig, 11.5.-15.5.1992.. Volltext nicht online. |
Rohwer, K. (1992) Modellierung und Berechnung von Strukturen aus Faserverbunden. Graduiertenkolleg "Modellierung, Berechnung und Identifikation mechanischer Systeme", Technische Universitaet "Otto von Guericke" Magdeburg, 4.6., 11.6., 18.6. 1992. Volltext nicht online. |
Rohwer, K. (1992) Erfahrungen mit einem modifizierten CG-Algorithmus zur geometrisch nichtlinearen Schalenberechnung. Technische Universitaet Braunschweig, Inst.f. Flugzeugbau, Braunschweig, 29.7. 1992. Volltext nicht online. |
Rohwer, K. (1992) On Various Computational Models of Laminated Composites. ECCOMAS Conference, Bruessel, 9.9. 1992.. Volltext nicht online. |
Rohwer, K. (1992) Berechnung von Strukturen aus Faserverbundwerkstoff. Im Rahmen des Graduiertrn Kolleg an der Universitaet Stuttgart, Stuttgart, 9.-10.11. 1992.. Volltext nicht online. |
Rohwer, K. and Geier, B. and Herrmann, A.S. (1992) Demonstration von Rechenbeispielen. Carl-Cranz-Ges. CCG, Lehrgang BW 2.02, "Strukturmechanische Berechnung im Leichtbau mit Faserverbundwerkstoffen", Braunschweig, 11.5.-15.5.1992.. Volltext nicht online. |
Rolfes, R. (1992) Finite Elemente fuer den Thermalhaushalt faserverstaerkter Strukturen. Sitzung: "Strukturen in der Hyperschall-Technologie", Braunschweig, 26.6. 1992.. Volltext nicht online. |
Rolfes, R. (1992) QUADTL and QUADQL: Application to nonlinear problems. Statusbesprechung mit der Fa. MacNeal-Schwendler GmbH, Amsterdam/Holland, 30.9. 1992.. Volltext nicht online. |
Rolfes, R. (1992) Nonlinear transient thermal analysis of composite structures. In: Tagungsband: "Numerical Methods in Engineering '92" Proc. of the First European Conference on Numerical Methodsin Eng., pp. 653-659. Elsevier, Amsterdam - London - New York - Tokyo. First European Conference on Numerical Methods in Engineering, Bruessel, 7.-11.9. 1992.. Volltext nicht online. |
Rosemann, H. and Dimotakis, P.(1) and Hall, J.L. (1) (1992) Flow Visualization in Compressible Turbulent Shear Layers. IUTAM Symposium "Eddy Structure Identification in Free Turbulent Shear Flow" 15-16 October 1992, Poitiers, France. Volltext nicht online. |
Rossow, C.-C. (1992) Flux Balance Splitting with Rotated Differences: A Second Order Accurate Cell Vertex Upwind Scheme. Vieweg, Braunschweig, Deutschland. 9th GAMM-Conference on Numerical Methods in Fluid Mechanics, Lausanne, 25.09.1992-27.09.1992. Volltext nicht online. |
Rossow, C.-C. (1992) Efficient Computation of Inviscid Flow Fields around Complex Configurations Using a Multiblock Multigrid Method. In: Communications in applied Numerical Methods, pp. 735-747. Volltext nicht online. |
Rossow, C.-C. and Godard, J.-L. and Hoheisel, H. and Schmitt, V. (1992) Investigations of Propulsion Integration Interference Effects on a Transport Aircraft Configuration. AIAA/SAE/ASME/ASEE 28th Joint Propulsion Conference and Exhibit, Nashville, July 6th-8th, 1992. Volltext nicht online. |
Rossow, Cord-Christian and Godard, Jean-Luc and Hoheisel, Heinz and Schmitt, Volker (1992) Investigation of Propulsion Airframe Interference Effects on a Transport Aircraft Configuration. AIAA conference, 1992, Nashville, TN (USA). Volltext nicht online. |
Rossow, Cord-Christian and Ronzheimer, Arno and Rudnik, Ralf (1992) Numerische Studie der Interferenzeffekte von zwei- und vierstrahligen Transportflugzeugkonfigurationen. In: Konferenzband. DGLR-Jahrestagung, 1992-10, Bremen (D). Volltext nicht online. |
Rues, D. (1992) Numerische Methoden in der Stroemungsmechanik II. In: Vorlesung WS 92/93 Georg-August Universitaet Goettingen. Volltext nicht online. |
Rues, D. (1992) Transportkoeffizienten in reagierenden Gasen. ETH Zuerich, RWTH Aachen, 24. April 1992. Volltext nicht online. |
Rues, D. (1992) Transportkoeffizienten in reagierenden Gasen. Vortrag Seminar ETH Zuerich, 14.02,1992. Volltext nicht online. |
Rues, D., Brenner, G., Prinz, U., (1992) Untersuchungen von Hyperschallstroemungen realer Gase um angestellte stumpfe Koerper. DFG-Schwerpunktprogramm, Stroemungssimulation mit Hochleistungsrechnern, 2. Kolloquium, Bonn, 21.-22.05,1992. Volltext nicht online. |
Ruf, M. and Filip, Pavel (1992) Transmission of PVQ compressed images over Gaussian and Rayleigh Fading Channels using combined Source and Channel Coding. Vortrag bei PCS'93 in Lausanne 17.-19. März 1993. Volltext nicht online. |
Runge, Hartmut and Bamler, Richard (1992) A Novel High Precision SAR Focussing Algorithm Based on Chirp Scaling. IEEE, New York, USA. IGARSS '92, Houston, USA, May 25 - 29, 1992. Volltext nicht online. |
Rätzer-Scheibe, H.-J. and Winstone, M.R.* (1992) Hot corrosion resistance of coated single crystal superalloys under marine conditions. 3rd International Symposium on High Temperature Corrosion and Protection of Materials, Les Embiez, France, May 25-29, 1992. Volltext nicht online. |
S
S. Pokorny, K. Engel, M. Faden, (1992) Berechnung der instatioinaeren Stroemung im gegenlaeufigen Geblaese. Kolloquium Energietechnik Ruhr-Uni Bochum. Volltext nicht online. |
S. Pokorny, K. Engel, M. Faden, (1992) Objektoriedntierte Methoden in der Stroemungsmechanik fuer massiv parallele Rechner. Kolloquium Stroemungsmaschinen Universitaet Essen, 29.06.92. Volltext nicht online. |
Saager, P. (1992) Integrationsverfahren fuer Echtzeitanwendungen. CCG-Lehrgang LR 11.01 "Flug- und Systemsimulation", Braunschweig, 23.-27.03.1992. Volltext nicht online. |
Saager, P. (1992) Einsatz der Simulationssprachen MPS10 und ADSIM zur Loesung spezieller Probleme bei der Echtzeitsimulation von Flaechenflugzeugen und Hubschraubern. CCG-Lehrgang LR 11.01 "Flug- und Systemsimulation", Braunschweig, 23.-27.03.1992. Volltext nicht online. |
Saager, P. (1992) Realtime Simulation as Development Tool. Helicopter In-Flight Simulator Research. In: Proceedings of the ADIUS Symposium, Incline Village, Nev., USA, 21 - 24 June 1992, pp. 37-54. Applied Dynamics International, Ann Arbor, Mi, USA. Volltext nicht online. |
Saliaris, C. (1992) Grundlagen der Modellierung von Flaechenflugzeugen. CCG-Lehrgang LR 11.01 "Flug- und Systemsimulation", Braunschweig, 23.-27.03.1992. Volltext nicht online. |
Sanchez, D. (1992) Eine parallel-verteilte Architektur fuer Rechnersehen und Telerobotik. In: TAT'92, 150-. Vortrag und Session Chairman TAT'92, Sektion Bildverarbeitung und Graphik, Aachen, 22.-23.09.92. Volltext nicht online. |
Sanchez, D. and Hirzinger, G. (1992) UNSPECIFIED In: Proc. IJCNN'92/International Joint Conference on Neural Networks, II, II-. IEEE, Piscataway, NJ, USA. IJCNN'92, Baltimore, Maryland, 07.-11.06.92. Volltext nicht online. |
Sanchez, David and Hirzinger, G. (1992) ERKENNEN UND LOKALISIEREN VON POLYEDERN IM 3-D RAUM. In: INFORMATIK AKTUELL: PARALLELE DATENVERARBEITUNG MIT DEM TRANSPUTER, pp. 201-208. SPRINGER-VERLAG BERLIN. TAT'91, AACHEN, 17.-18. SEPTEMBER 1991. Volltext nicht online. |
Sandau, R. and Oertel, D. (1992) The Wide-Angle Optoelectronic Stereo Scanner WAOSS for the Soviet Mars 94/96 Missions. In: SPACE 92, Proceedings of the Third International Conference (1992), pp. 2241-2251, pp. 2241-2251. Volltext nicht online. |
Sandham, N.D. (1) (Vortragender), Adams, N.A., (1992) Numerical Simulation of Boundary-Layer Transition at Mach Two. In: Fourth European Turbulence Conference, Delft, Niederlande, 30. Juni - 3. Juli 1992. Volltext nicht online. |
Sarma, G.S.R. (1992) Chemically Reacting Couette Flow. STAB - Workshop, Goettingen, 8.-10.11.1992. Volltext nicht online. |
Sarma, G.S.R. (1992) On the Numerical Analysis of Chemically Reacting Hypersonic Flows. Angenommener Beitrag zum IUTAM Symposium "Aerothermo-Chemistry of Spacecraft and Associated Hypersonic Flows", Marseille, 1.-4.09.1992. Volltext nicht online. |
Sauerland, S. and Lohoefer, G. and Egry, I. (1992) Positionierkraefte und Leistungsabsorbtion in der elektromagnetischenSchwebeschmelzanlage TEMPUS. eingereicht fuer Tagungsband DGLR 1992. Volltext nicht online. |
Sausen, R. (1992) The Global Atmosphere General Circulation Model ECHAM. 1st AERONOX SP-3 workshop, De Bilt, Niederlande, 28.-29.4.1992. Volltext nicht online. |
Sausen, R. (1992) Modelling Activities in AERONOX SP-3. Joint meeting of the ECAC/ANCAT aircraft emission database group and the AERONOX sub-project 3 group, DLR OP, 16.6.92. Volltext nicht online. |
Sausen, R. (1992) AERONOX Overview. High Speed-Research Program/Atmospheric Effects of Stratospheric Aircraft. Annual Meeting, Virginia Beach, VA, USA, 17.-22.5.92. Volltext nicht online. |
Sausen, R. (1992) The European Research Project AERONOX - Impact of NO2 Emissions from Aircraft upon the Atmosphere at Flight Altitude 8-15 km. In: Atmospheric Effects of Stratospheric Aircraft Flyer. Special annual meeting report issue, NASA High-Speed Res. Progr., Washington, USAAtmospheric Effects of Stratospheric Aircraft Flyer, pp. 5-6. Volltext nicht online. |
Sausen, R. (1992) On the Cold Start of Coupled Atmosphere-Ocean Models. EGS, XVII General Assembly, Edinburgh, UK, 6.-10.4.92. Volltext nicht online. |
Sausen, R. (1992) Klimasimulationen mit gekoppelten Atmosphaere-Ozean-Modellen. Geoophysikalisch-Meteorologisches Kolloquium der Univ. Köln, 9.7.92. Volltext nicht online. |
Sausen, R. (1992) Der anthropogene Anteil am Treibhauseffekt. Initiativkreis kologie, Studium Generale an den Univ. Stuttgart und Hohenheim, Akademie f. Natur- u. Umweltschutz Baden-W., 11.6.1992. Volltext nicht online. |
Sausen, R. (1992) Simulation des globalen Klimas mit gekoppelten Atmosphaere-Ozean-Modellen. Seminar des Inst. f. Meteorologie undGeophysik der Univ. Innsbruck, 3.6.92. Volltext nicht online. |
Sausen, R. (1992) Klimamodellierung. Sonderkolloquium des Inst. f. Meteorologie der FU Berlin, 17.1.1992. Volltext nicht online. |
Sausen, R. (1992) Klimasimulationen mit gekoppelten Atmosphaere-Ozean-Modellen. Met. Koll. der Univ. Hannover, 12.12.1991. Volltext nicht online. |
Sausen, R. (1992) On the Impact of Aircraft Emissions Upon the Atmosphere. IATA Meeting on Aircraft Emissions,Montreal, Kanada, 23.9.92. Volltext nicht online. |
Sausen, R. (1992) Auswirkungen des Luftverkehrs auf das Klima (eingel. Vortrag). Herbstsitzung des Arbeitskreises Energie der Deutschen Physikalischen Gesellschaft, Bad Honnef, 15.-16.10.92. Volltext nicht online. |
Sausen, R. (1992) On the Cold Start Problem of Coupled Atmosphere-Ocean-Models. Second Intern. Conf. on Modelling of Global Change and Variability, Hamburg, 7.-11.9.92. Volltext nicht online. |
Sausen, R. and König, W.(*) and Sielmann, F.(*) (1992) Objektive Identifikation individueller Zyklonen und Blockierungen. Deutsche Meteorologen-Tagung 1992, Berlin, 16.-20.3.1992. Volltext nicht online. |
Sax, H. (1992) Erdbeobachtung mit Satelliten. In: 5. Raumfahrt-Kolloquium, FH Aachen, 12.11.92. Volltext nicht online. |
Sax, H. and et al., (1992) Orbital Debris: An International Policy Issue. In: Preprint B.8 - M.3.12, XXIX COSPAR Plenary Meeting, World Space Congress, 28.8. - 5.9.92, Washington, D.C., USA. Volltext nicht online. |
Schaefer, B. and Burghaus, G. and Schlenger, M. and Seth, A. (1992) Telerobotic Test and Training Facility for Ground-Based In-Orbit Servicing. In: Proceedings (1992). 2nd Workshop on Simulators for European Space Programmes, ESTEC, Noordwijk, The Netherlands, 25-27 Nov. 1992. Volltext nicht online. |
Schafranek, D. (1992) Tentative Criteria for Longitudinal Handling Qualities of Aircraft with Advanced Flight Control Systems. Lecture Series at the National Aeronautical Laboratory (NAL), Bangalore, India, 30 November - 08 December 1992. Volltext nicht online. |
Schafranek, D. (1992) Handling Qualities Research - DLR Experience and Flight Test Results on Relaxed Static Stability. Lecture Series at the National Aeronautical Laboratory (NAL), Bangalore, India, 30 November - 08 December 1992. Volltext nicht online. |
Schafranek, D. and Wilhelm, K. (1992) Preparation and Execution of Handling Qualities Experiments. Lecture Series at the National Aeronautical Laboratory (NAL), Bangalore, India, 30 November - 08 December 1992. Volltext nicht online. |
Schafranek, D. and Wilhelm, K. (1992) Example of Execution and Analysis of Handling Qualities Experiments. Lecture Series at the National Aeronautical Laboratory (NAL), Bangalore, India, 30 November - 08 December 1992. Volltext nicht online. |
Schall, W. (1992) Removing Small Debris From Earch Orbit. In: Tagungsband zum "Stand der Space Debris-Forschung in Deutschland und internationale Regulierungsfragen, DARA, Bonn 9.12.92. s.o.. Volltext nicht online. |
Schanz, P. (1992) Faserkeramik durch Fluessigsilizierungvon C/C. Faserkeramikwerkstoffe- Eigenschaften und Anwendungen; Seminar Carl-Cranz-Ges., DLR-Stuttgart, 24./25.11.92. Volltext nicht online. |
Scharf, H.-D., (RWTH Aachen), and Esser, P. (RWTH Aachen), Esser, E.P. (RWTH Aachen), and Funken, K.-H. and Schneider, G. (1992) Das SOLARIS-Experiment: Demonstration solar-photochemischer Synthesenin einem linienfokussierenden Kollektor auf der Plataforma Solar de Almeria. SOTA-Schlusspraesentation, Koeln, 10. u. 11.06.92. Volltext nicht online. |
Schelb, W. and Welpmann, K. and Haszler, A. and Peters, M. and Jäger, H. (1992) Thermomechanical Treatments for the Production of thick Recrystallized 8090 Al-Li Sheet. In: Aluminium Lithium, M.Peters, P.-J. Winkler, Eds., pp. 315-320. DGM, Oberursel. Volltext nicht online. |
Schenk, A. (1992) Experimentelle Modalanalyse - Ein modernes Hilfsmittel zur Loesung strukturdynamischer Probleme. Eine Einfuehrung in den gleichnamigen Lehrgang. Seminar DR 1.01 der Carl-Cranz-Gesellschaft: "Experimentelle Modalanalyse - Ein modernes Hilfsmittel zur Loesung strukturdynamischer Probleme", Goettingen, 18.-21.05.1992.. Volltext nicht online. |
Schenk, A. (1992) Multiple Input Verfahren am Beispiel des Eigensystem Realization Algorithm. Seminar DR 1.01 der Carl-Cranz-Gesellschaft: "Experimentelle Modalanalyse - Ein modernes Hilfsmittel zur Loesung strukturdynamischer Probleme", Goettingen, 18.-21.05.1992.. Volltext nicht online. |
Schenk, A. (1992) Berechnung von Ausschwingzeitreihen nach der Zufallsdekrementfunktion. Seminar DR 1.01 der Carl-Cranz-Gesellschaft: "Experimentelle Modalanalyse - Ein modernes Hilfsmittel zur Loesung strukturdynamischer Probleme", Goettingen, 18.-21..05.1992.. Volltext nicht online. |
Schenk, A. (1992) Das Ibrahim Zeitbereichsverfahren. Seminar DR 1.01 der Carl-Cranz-Gesellschaft: "Experimentelle Modalanalyse - Ein modernes Hilfsmittel zur Loesung strukturdynamischer Probleme", Goettingen, 18.-21.05.1992.. Volltext nicht online. |
Schenk, A. (1992) Die modale Identifikation bei unbekannter stationaerer Zufallserregung. Kolloquium fuer Mechanik und Regelungstechnik an der Universitaet - Gesamthochschule Siegen in Zusammenarbeit mit dem VDI Arbeitskreis "Mess- und Regelungstechnik" am 02.07.1992.. Volltext nicht online. |
Schenk, A. (1992) Zur Problematik der Systemidentifikation in Flugschwingversuchen. Deutscher Luft- und Raumfahrtkongress DGLR-Jahrestagung 1992 29. Sept. bis 02. Okt. 1992 in Bremen, DGLR Jahrbuch 1992 I.. Volltext nicht online. |
Schickel, K.-P. and Hoffmann, H.-E. and Kriebel, K.-T. (1992) Identifikation von vereisenden Wasserwolken mittels NOAA-AVHRR-Satellitenbildern. In: Proc. 11th Intern. Conf. on Clouds and Precipitation, Montreal, Kanada, 17.-21.8.92, pp. 399-44. Volltext nicht online. |
Schickel, K.P. (Vortragender) and Hoffmann, E. and Kriebel, K.-T. (1992) Identification of Icing Water Clouds by NOAA AVHRR Satellite Data. In: Proc. 11th Intern. Conf. on Clouds and Precipitation, Montreal, Canada, 17-21 August 1992, pp. 399-400. 11th Intern. Conf. on Clouds and Precipitation, Montreal, Canada, 17-21 August 1992. Volltext nicht online. |
Schiel, W. and Cordes, S. (1992) Bau und Test eines 44 m/2 Membranheliostaten. Abschlusspraesentation zum Projekt SOTA. Volltext nicht online. |
Schiller, G. and Borck, V. and Henne, R. and Kayser, A. (1992) Intermittent Operation of Vacuum Plasma Sprayed Electrodes for Alkaline Water Electrolysis. In: Proc. 9th WHEC, Vol. 1, pp. 409-418. Proc. 9th WHEC, Paris, 22 - 25 June 1992. Volltext nicht online. |
Schilz, J. (1992) Formation and Properties of Ge-Si Solid Solutions. Window-on-Science Visit der US-Air Force, 21. Juli - 25. August 1992. Volltext nicht online. |
Schilz, J. and Langenbach, M. (1992) Powder metallurgy of Ge, Si and GeSi. 10th International Conference on Crystal Growth (ICCG 10), San Diego, CA. August 16-21, 1992. Volltext nicht online. |
Schilz, J. and Langenbach, M. (1992) Powder Metallurgy of Ge, Si and Ge-Si. In: Journal of Crystal Growth (Proc. of the 10th Int. Conf. on Crystal Growth, August 1992, San Diego, CA). Volltext nicht online. |
Schimke, D. and Guyomard, C. and Lane, R. M. T. and Bellazzi, A. and Charlton, M. T. and Pausder, H.-J. (1992) The European ACT Programme: Complementary Use of Ground Based Simulation Facilities and Experimental "Fly by Wire/Light" Helicopters. In: Proceedings of the 18th European Rotorcraft Forum, Avignon, France, 15 - 18 September 1992. Volltext nicht online. |
Schlager, H. (1992) Nutzung eines geplanten Stratosphärenforschungsflugzeugs STRATO-2C. DFG-Kolloquium z. Schwerpunkt "Grundlagen der Auswirkungen der Luft- und Raumfahrt auf die Atmosphäre", München, 9.-10.3.1992. Volltext nicht online. |
Schlotzhauer, G. (1992) WAOSS - Onboard Image Data Compression. HRSC/WAOSS Coinvestigator Team Meeting, Oberpfaffenhofen, 8-9 October 1992.. Volltext nicht online. |
Schmerwitz, D. (1992) Integrierte Messanlage zur Flugleistungsvermessung in der DG 300/17. Idaflieg-Wintertreffen, Esslingen, 09.-11.01.1992. Volltext nicht online. |
Schmidt, W. (1992) Optische Sensornetzwerke. CCG-Kurs "Optische Sensoren", Braunschweig, 23.11.-27.11.92. Volltext nicht online. |
Schmitt, D.-R. and Swoboda, H. (1992) Weltrauminstrument SESAM. Jahrestagung Deutsche Gesellschaft fuer angewandte Optik, Friedrichroda, 9.-13.6.1992. Volltext nicht online. |
Schmitt, H. (1992) Description of Viscous-Inviscid Interaction Using Boundary Elements. In: C.A. Brebbia, P.W. Partridge (Eds.): Boundary Elements in Fluid Dynamics, Computational Mechanics Publications,Boston, pp. 93-107. Volltext nicht online. |
Schmitt, H. (1992) Description of Viscous-Inviscid Interaction Using Boundary Elements. International Conference on Boundary Elements and Fluid Dynamics, Southampton, 29.-30. April 1992. Volltext nicht online. |
Schmitt, H. (1992) High Reynolds Number Flow about a Prolate Spheroid Moving Near Ground. In: C.A. Brebbia (ed.): Boundary Element Technology VI, Computational Mechanics Publications, Southampton, pp. 13-27. Volltext nicht online. |
Schmitz, G. and Klein, H. and Woermann, D.* *Uni Koeln (1992) Phase Separations at Gas Liquid Critical Points. VIII ESA Symposium on Fluid Sciences in Microgravity. Volltext nicht online. |
Schmullius, C. (Vortragende) and Nithack, J. (1992) Untersuchung der Radarrueckstreuung landwirtschaftlicherFlaechen mit flugzeuggetragenen multifrequenten und multipolarisierten SAR-Sensoren. Jahrestagung der DGPF, Arbeitskreissitzung "Interpretation von Fernerkundungsdaten", Jena, 14.-16.10.92.. Volltext nicht online. |
Schmullius, Ch. (1992) Radarfernerkundung landwirtschaftlicher Flaechen mit einem flugzeuggetragenen L-, C- und X-Band Scatterometer. Wissenschaftliches Kolloquium, DLR, NE-HF, Oberpfaffenhofen, 6.2.92.. Volltext nicht online. |
Schmullius, Ch. (Vortragende), Nithack, J., (1992) Frequency and Polarization Dependent Backscatter Variations in Multi-temporal, High-resolution SAR Images from Agricultural Fields. Vortrag, gehalten auf Microwave Signature "92, Igls-Innsbruck, 1.-3.7.92, Austria Proc. Microwave Signature '92. Volltext nicht online. |
Schmullius, Ch. (Vortragende), Nithack, J., (1992) High-Resolution SAR Frequency and Polarization Dependent Backscatter Variations from Agricultural Fields. IEEE, Piscataway, N.J.. Vortrag, gehalten auf Internat. Geoscience and Remote Sensing Symp. (IGARSS) '92, Houston, Texas, 26.-29.5.92 Proc. IEEE Cat.Nr. 92 CH 3041-1. Volltext nicht online. |
Schmullius, Ch. (Vortragende), Nithack, J., (1992) Comparison of JPL-AIRSAR and DLR E-SAR Images from the MAC Europe '91 Campaign over Testsite Oberpfaffenhofen: Frequency and Polarization Dependent Backscatter Variations from Agricultural Fields. Vortrag, gehalten auf: Third Annual Airborne Geoscience Workshop, JPL, Pasadena, USA, 1.-5.6.92 Proc. JPL Publication 92-14. Volltext nicht online. |
Schneider, H. (1992) Hochtemperatur-Keramiken. Werkstoff-Kolloquium der DLR am 10.12.1992. Volltext nicht online. |
Schneider, H. (1992) Cr-Incorporation in Mullite. Kolloquiumsvortrag Universitlät Cadiz, 19.11.1992. Volltext nicht online. |
Schneider, H. (1992) Ceramic Activities in the Institute of Materials Research (DLR). Kolloquiumsvortrag, Universität Cadiz, 20.11.1992. Volltext nicht online. |
Schneider, H. (1992) Hochleistungskeramiken. Kolloquiumsvortrag, Universität Hannover, 23.10.1992. Volltext nicht online. |
Schneider, H. (1992) Mullit-Keramiken. Kolloquiumsvortrag, Universität Hannover, 14.04.1992. Volltext nicht online. |
Schneider, H. (1992) Mullitkeramiken. Kolloquiumsvortrag Freiberg, 30.01.1992. Volltext nicht online. |
Schneider, H. (1992) Traditionelle Keramiken. Vorlesung Universität (TH) Hannover, WS 92/93. Volltext nicht online. |
Schneider, H. (1992) Angewandte Mineralogie: Technische Keramik. Vorlesung Universität Münster, WS 91/92. Volltext nicht online. |
Schneider, H. and Braue, W. (1992) Vergleichende TEM-Gefuegeuntersuchungen von explosionsverdichtetem bzw. thermisch gespritztem Mullitkeramiken. 70. Jahrestagung der Deutschen Mineralogischen Gesellschaft, Tübingen, 12.-20.09.1992. Volltext nicht online. |
Schneider, W. and Dech, S. (1992) Telemetry and Environmental Remote Sensing. In: Proceedings of the European Telemetry Conference ETC 92 Garmisch-Partenkirschen, 12.-14. May 1992, pp. 17-22. Volltext nicht online. |
Schnell, M. (1992) Matched Filter-Bounds fuer Mobilfunkkanaele. Institutskolloquium in OP am 11.3.1992. Volltext nicht online. |
Schnell, M. (1992) Matched Filter Bounds - Berechnungsschema und Anwendung fuer Mobilfunkkanaele. ITG-Sitzung "CDMA in Mobilfunksystemen, Nuernberg, 29./30.6.1992. Volltext nicht online. |
Schnell, M. and Werner, M. (1) (1992) Comparison Between Different Transmission Schemes for Mobile Radio Channels. In: Conference Proceedings of the ISSSE'92, 2, pp. 705-708. Intern. Symp. on Signals, Systems and Electronics (ISSSE'92) 1. - 4. Sept. 1992, Paris, Frankreich. Volltext nicht online. |
Schnitt, D.-R. and Ringel, G. and Kratz, F. (1992) Interferenzmikroskopie und Oberflaechenanalyse. CCG-Kurs "Optische Sensoren", Braunschweig, 23.11.-27.11.92. Volltext nicht online. |
Schodl, R. (1992) Das Laser-Zwei-Fokus-Stroemungsgeschwindigkeitsmeverfahren- Prinzip, Anwendungsbeispiele, neue Entwicklungen. Seminarvortrag am 08.05.92 am Inst. fuer Fluid- und Thermodynamik, Universitaet-GH-Siegen. Volltext nicht online. |
Schott, J. U. and Kranz, A. R. and Gartenbach, K. and Zimmermann, M. (1992) Particle Radiation Mapping in Microorganisms with Charge Coupled Devices (CDDs). Imaging Future, The Royal Photographic Society, University of Cambridge, U.K., 21.-25.09.92. Volltext nicht online. |
Schreier, Franz (1992) A Comparison of Computational Approaches for the Voigt Function. In: Proceedings of the 14th Annual Review Conference on Atmosphere Transmission Models, June 1991, PL-TR-92-2059, Special Reports, 267, pp. 320-328. Volltext nicht online. |
Schroeder, Manfred (1992) Spatial Resolution of a digital CCD-Camera Rumliches Auflsungsvermgen einer digitalen CCD-Kamera. ISPRS Congress, Washington, D.C., 1992, International Archives of Photogrammetry and Remote Sensing Volume XXIX, B1. Volltext nicht online. |
Schroer, A. (1992) Simulation of an Electrodynamic Tethered Satellite System in the Framework of a Resistive MHD-Model. In: Abstract: Annales Geophysicae Supplement III, Vol.10. Vortrag: XVII General Assembly of the European Geophysical Society, 6.-10.4., Edinburgh, 1992. Volltext nicht online. |
Schroth, A. (Vortragender) and Bethke, K.H., Chandra, M., and Herdeg, W. *) and Hornbostel, A. and Fuchs, U. **) (1992) Ground Based Polarimetric Radar Imaging at DLR, an Overview. SPIE, Bellingham, Washington, USA. Vortrag: SPIE '92 Internat. Symp., San Diego, USA, 19.-24.7.92. Proc.: SPIE - The Internat. Society for Optical Engineering "Radar Polarimetry", ISBN 0-8194-0921-9. Volltext nicht online. |
Schulte, K. and Trautmann, K.-H. (1992) Mechanical Testing of Metal Matrix Composites. European Conference on Composites Testing and Standardisation September 8-10, 1992, Amsterdam, the Netherlands. Volltext nicht online. |
Schulte, K. and Trautmann, K.-H. and Leucht, R. and Minoshima, K. (1992) Fatigue Response of Metal Matrix Composites. ASTM Symposium on Cyclic Deformation, Fracture and NDE of Advanced Materials, Miami, FL, USA, November 16-17, 1992. Volltext nicht online. |
Schultes, K.(1) and Kensche, Ch. (1992) Das Verhalten von vorbelasteten und vorgeschaedigten Rotorblaettern und ihrer Krafteinleitung unter verschiedenartiger Ermuedungsbelastung. DEWEK '92-Deutsche Windenergie-Konferenz; Wilhelmshaven: Deutsches Windenergieinstitut, 28./29.Okt.92. Volltext nicht online. |
Schultz, K.-J. and Splettstoesser, W. R. (1992) Model Tail Rotor Noise Study in the DNW - Measured Acoustics, Blade Pressures, Noise Predictions. 18th European Rotorcraft Forum, Avignon, 15.09.-18.09.1992. Volltext nicht online. |
Schultz, K.-J. and Splettstoesser, W.R. (1992) Helicopter Main Rotor/Tail Rotor Noise Radiation Characteristics from Scaled Model Rotor Experiments in the DNW. DGLR/AIAA 14th Aeroacoustics Conference, 11.-14. Mai 1992, Aachen. Volltext nicht online. |
Schulz, P. (1992) BAK - Ein Experimentalsystem zur Bildaufklaerung. Praesentation von Arbeiten des Instituts fuer Flugfuehrung, Bildverarbeitung und Navigation, Braunschweig, 3.9.92. Volltext nicht online. |
Schulz, P. (1992) Fernsteuerung eines Videotrackers. 15. Arbeitsgruppensitzung "Bildaufklaerung" des BMVG, Braunschweig, 12.-13.10.1992. Volltext nicht online. |
Schulz, P. (1992) Statusbericht zum Studienvertrag ueber "Experimentalsystem BAK, Phase 4". 15. Arbeitsgruppensitzung "Bildaufklaerung" des BMVG, Braunschweig, 12.-13.10.1992. Volltext nicht online. |
Schulz, P. (1992) Ausgewaehlte Experimente zur Bildaufklaerung. Vorstellung des Flugbetriebes fuer Offiziere des Verteidigungs= kommandos, Braunschweig, 10.12.1992. Volltext nicht online. |
Schumann, U. (1992) Numerical Simulation of Turbulent Convective Flow Over Wavy Terrain. CERFACS Workshop on Atmospheric Flows in Complex Terrain, Toulouse, Frankreich, 27.7.92 (eingeladen). Volltext nicht online. |
Schumann, U. (1992) Klimaauswirkungen des Luftverkehrs. Seminar des Inst. f. Luft- und Raumfahrt der TU Berlin, 3.7.1992. Volltext nicht online. |
Schumann, U. (1992) STRATO-2C. Statusseminar im BMFT-Ozonforschungsprogramm, Bonn, 26.6.92. Volltext nicht online. |
Schumann, U. (1992) Die turbulente Hangwindgrenzschicht. Seminar für Strömungslehre und Strömungsmaschinen, Univ. Karlsruhe (TH), 21.5.1992. Volltext nicht online. |
Schumann, U. (1992) Übersicht über Fragestellung und laufende Forschungsprogramme. Fortbildungstag der Deutschen Meteorologischen Gesellschaft, Zweigverein München, Weihenstephan, 8.5.92. Volltext nicht online. |
Schumann, U. (1992) Der Luftverkehr unter Klimaaspekten. Initiativkreis Ökologie, Studium Generale an den Universitäten Stuttgart und Hohenheim, Akademie für Natur- und Umweltschutz, Baden-Württemberg, 7.5.1992. Volltext nicht online. |
Schumann, U. (1992) Simulations and Parametrizations of Large Eddies in Convective Atmosphere Boundary Layers. In: Proc. of a Workshop held at ECMWF on Fine-scale modelling and the development of parametrization schemes, Reading, UK, 16.-18.9.91, pp. 21-51. | ![]() |
Schumann, U. (1992) Kritische Skala der Reaktion der konvektiven Grenzschicht auf variable Oberflächeneigenschaften. Deutsche Meteorologen-Tagung, Berlin, 16.-20.3.1992. Volltext nicht online. |
Schumann, U. (1992) Auswirkung des Luftverkehrs auf die Atmosphäre. Koll.d.DFG-Schwerpunktprogramms 'Grundlagen der Auswirkungen der Luft- u. Raumfahrt auf die Atmosphäre, München, 9.-10.3.92. Volltext nicht online. |
Schumann, U. (1992) Large-Eddy Simulation of Turbulent Convective Boundary Layers. Wiss. Jahrestagung der Gesell. f. Angewandte Mathematik u. Mechanik (GAMM), Leipzig, 24.-28.3.92. Volltext nicht online. |
Schumann, U. and Arnold, F. and Heimann, D. and Reinhardt, M.E. and Sausen, R. and Schlager, H. (1992) On the Effect of High-Flying Air-Traffic on the Atmosphere. High Speed-Research Program/Atmospheric Effects of Stratospheric Aircraft. Annual Meeting, Virginia Beach, VA, USA, 17.-22.5.1992. Volltext nicht online. |
Schwamborn, D. (1992) 3D-Stator-Rotor Stroemung durch eine Turbinenstufe. 3. Statusseminar der Arbeitsgemeinschaft 'Hochtemperatur-Gasturbine', am 3. und 4. Dezember 1992 in Koeln/Porz (DLR). Volltext nicht online. |
Schäfer, B. and Burghaus, G. and Schlenger, M. and Seth, A. (1992) Telerobotic Test and Training Facility for Programmes Ground-Based In-Orbit Servicing. In: Proceedings ESA 2nd Workshop. ESA 2nd Workshop, Nordwijk, Niederlande, 25.-27.11. 1992. Volltext nicht online. |
Schäfer, B. and Schlenger, M. (1992) Ground Support for Operations of Telerobotic In-Orbit Servicing. In: Proceedings IAF. 43rd Congress of the International Astronautical Federation, Washington, USA, 28.8.-5.9.1992. Volltext nicht online. |
Schäfer, B.E. and Schlenger M., (1992) Ground Support for Operations Telerobotic In-Orbit Servicing. In: Proc. (1992). 43rd Congress of the International Astronautical Federation, Washington, DC, USA, Aug 28 - Sept 5, 1992 (Paper IAF-92-0721). Volltext nicht online. |
Schönermark, M. v. (1992) Fernerkundung von Vegetationssignalen. Institutskolloquium am Meteorologischen Institut der Humboldt-Universität Berlin, 9. Dezember 1992.. Volltext nicht online. |
Schönermark, M. v. (1992) Nutzung des PRIRODA-Moduls fuer Wasserhaushaltsuntersuchungen ueber Land. Deutsche Meteorologische Gesellschaft, Zweigverein Leipzig, "Meteorologische Fernmeß- und Beobachtungsverfahren", Leipzig, 16. Dezember 1992.. Volltext nicht online. |
Scientific Team: T.-N. Iversen, etal. USO Team: Blume H.T., etal., (1992) The USO-Concept Applied to a Biological Model Experiment. In: Proceedings of Satellite Symposium 4, pp. 241-244. ESA Publications Division, ESTEC, Noordwijk, The Netherlands. International Space Year Conference, Munich, 30 March-4 April 1992. Volltext nicht online. |
Secchi, Patricia and Runge, Hartmut and Paganone, A. (1992) A Control System for the X-SAR Precision Processor. In: Proceedings Ada in Aeorspace, Third Symposium, Vienna 09.11.-13.11.1992. Eurospace, Paris. Volltext nicht online. |
Seidensticker, K.J. (1992) The DLR Small Chamber-Opportunity for Mars simulation experiments. In: Mars-Simulation workshop, Bad Honnef, 27.-29.1.1992. Volltext nicht online. |
Seidensticker, K.J. and Kochan, H. (1992) Gas dynamics of sublimating cometary analogues: Results from recent KOSI experiments. European Geophysical Society XVII General Assembly, Edinburgh, 6.-10.4.1992. Volltext nicht online. |
Seidensticker, K.J. and Kochan, H. (1992) Gas dynamics of sublimating ice/dust samples. In: Second International Planetary Science Conference, Division for Planetary Sciences of the AAS. München 12.-16.10.1992. Volltext nicht online. |
Seifert, F.M. (1992) Qualitaetsanalyse und Kalibrierung von SAR-Bildern des ERS-1. Kolloquium am Institut fuer Hoechstfrequenztechnik und Elektronik, Universitaet Karlsruhe, 18.3.1992. Volltext nicht online. |
Seifert, F.M. (1992) Qualitaetsanalyse und Kalibrierung von ERS-1 SAR-Bildern. Wissenschaftliches Kolloquium, DLR, NE-HF, Oberpfaffenhofen, 9.4.1992.. Volltext nicht online. |
Seifert, Peter and Zink, Manfred (1992) Inflight Antenna Diagram Determination of Spaceborne and Airborne SAR-Systems. IEEE, Piscataway, N.J.. Vortrag, gehalten auf: IGARSS '92, Houston, Texas, USA, 26.-29.5.92 Proc. IEEE Cat.Nr. 92 CH 3041-1, Vol. I. Volltext nicht online. |
Shipley, P. P. and Birch, N. T. and Riedel, H. and Hostmann, K.-H. and Luecking, P. (1992) A European Collaborative NLF Nacelle Flight Demonstrator. DGLR/AARF/RAeS First European Forum on Laminar Flow Technology, Hamburg, 16.03.1992-18.03.1992. Volltext nicht online. |
Sienel, W. (1992) Algorithmen fuer die Baumstrukturierte Zerlegung. Vortrag TU Muenchen, 23.06.92. Volltext nicht online. |
Sienel, W. (1992) Algorithms for tree structured decomposition. In: Proc. Conference on Decision and Control, 2, pp. 739-740. 31st IEEE Conf., Tucson/Arizona, Dec. 1992. Volltext nicht online. |
Simen, M.(1) (1992) Local and Non-Local Stability Theory of Spatially Varying Flows. In: Proc. of the ICASE/NASA Langley Research Center Workshop on Transition and Turbulence, July 8-August 2, 1991, Hampton, Va., USA., pp. 181-201. Springer-Verlag, New York. Volltext nicht online. |
Sinapius, M. (1992) Experimentelle Erprobung der Modalkraftsimulation dynamischer Lasten. Institut fuer Leichtbau RWTH Aachen, Seminarvortrag am 14.07.1992.. Volltext nicht online. |
Sinapius, M. (1992) Verfahren der Modalsynthese. Seminar DR 1.01 der Carl-Cranz-Gesellschaft: "Experimentelle Modalanalyse - Ein modernes Hilfsmittel zur Loesung strukturdynamische Probleme", Goettingen, 18.-21.05.1992.. Volltext nicht online. |
Sinapius, M. and Breitbach, E. (1992) Experimentelle Ergebnisse aus der Modalkraftsimulation dynamischer Lasten. Deutscher Luft- und Raumfahrtkongress DGLR-Jahrestagung 1992 29. Sept. bis 02. Okt. 1992 in Bremen, DGLR Jahrbuch 1992 I.. Volltext nicht online. |
Skarpelis, C. (1992) Planungs- und Organisationsaspekte staatlicher Forschungsfoerderung im Bereich des Arbeits- und Gesundheitsschutzes. Workshop "Forschungskonzepte" der Internationalen Sektion Forschung über die Verhütung von Arbeitsunfällen und Berufskrankheiten (IVSS), Sankt Augustin, 16. und 17. September 1992.. Volltext nicht online. |
Skarpelis, C. (1992) Ganzheitliche Gestaltung von Logistikkonzepten. Workshop "Ganzheitliche Logistikkonzepte - Möglichkeiten und Grenzen", Bonn, 9. Juli 1992.. Volltext nicht online. |
Skarpelis, C. (1992) Handel - Stiefkind der Forschung? Workshop "Arbeit und Technik im Handel - Innovationen für die Zukunft", Bonn, 21. und 22. Mai 1992.. Volltext nicht online. |
Skarpelis, C. (1992) Laudatio bei der Verleihung des Foerderpreises 1992 der Gesellschaft fuer Rationalisierung fuer die beste Arbeit auf dem Gebiet der Integration von Humanisierung und Rationalisierung. Verleihung des GfR-Förderpreises am 8. Oktober 1992 in der RWTH Aachen.. Volltext nicht online. |
Skarpelis, C. (1992) Die Unverdaubarkeit der Paradigmenwechsel. In: Möglichkeiten und Grenzen der KI-Folgenabschätzung.. Werkstattgespräch "Technikfolgenabschätzung der KI-Folgen einer Diskussion"im Rahmen der 16. Fachtagung für künstliche Intelligenz (GWAI '92) , Bonn, 31. August bis 3. September 1992.. Volltext nicht online. |
Sobieczky, H., Qian, Y.J., (1992) Extended Mapping and Characteristics Techniques for Inverse Aerodynamic Design. In: Paper presented at 'International Conference on Inverse Design Concepts and Optimization in Engineering Sciences (ICIDES III)' Washington, D.C., 23.-25. October 1991, pp. 281-292. Volltext nicht online. |
Sobieczky, H., Stroeve, J.C., (1992) Generic Supersonic and Hypersonic Configurations. In: 9th AIAA Applied Aerodynamics Conference 1991. 9th AIAA Applied Aerodynamics Conference, Baltimore, MD, 23-26 September 1991. Volltext nicht online. |
Sonar, Th. (1992) Loesung der kompressiblen Eulergleichungen auf adaptiven Triangulierungen. Vortrag auf Einladung des IBM-Forschungszentrums, Heidelberg 26.02.1992. Volltext nicht online. |
Sonar, Th. (1992) Adaptive Berechnung kompressibler Stroemungsfelder. GAMM Seminar, Adaptive Methoden, Universitaet Hannover, 5.-6. Maerz 1992. Volltext nicht online. |
Spannhake, B. (1992) Technisch-organisatorischer Wandel und europäischer Binnenmarkt. II. Int. Kolloquium über Arbeitsmedizin in der Bauwirtschaft, 20.-22.10.1992, Baden-Baden - Europäisches Jahr für Sicherheit und Gesundheitsschutz am Arbeitsplatz 1992. Volltext nicht online. |
Spindler, G. (1992) Ueber die Arbeiten zum Stuttgarter FEL-Projekt. TH Darmstadt 1992.. Volltext nicht online. |
Spindler, G. and Renz, G. and Conde, M.E. and Bekefi, G. (1992) Analysis of the electron dynamics in a Raman Free Electron Laser with Reversed Axial Guide Magnetic Field. In: Proceedings (1992).. BEAMS '92. Volltext nicht online. |
Splettstoesser, W. R. (1992) Current DLR Research on Helicopter Aeroacoustics and Status of the HHC Aeroacoustics Rotor Test (HART). 28th Semi-Annual Meeting US/German MoU on Helicopter Aeromechanics, Moffet Field, June 1st, 1992. Volltext nicht online. |
Splettstößer, W. R. and Schultz, K.-J. and Kube, R. (1992) DLR-Forschung zur Lärmminderung durch höherharmonische Rotorblattsteuerung. Kommissionssitzung im ISL, St.-Louis, Frankreich, 31.03.-01.04.1992. Volltext nicht online. |
Splitt, G. and Forster, H. (1992) Mehrelemente-Satelliten-Mobilfunk-Antennen für GPS- und Kommunikationsanwendung in Microstrip-Technologie. In: Proceedings Mehrelementeantennen, Bad Dürkheim, pp. 91-94. ITG im VDE, Frankfurt. Fachausschuß "Antennen" der ITG im VDE, Bad Dürkheim, 1.-2.4.92. Volltext nicht online. |
Stahl, B. (1992) Investigations on the Formation of Ice Crystals in the Cryogenic Wind-Tunnel, Cologne. Wind-Tunnels and Wind-Tunnel Test Technique, Southampton, 14-17 September 1992. Volltext nicht online. |
Starken, H. (1992) Performance of Controlled Diffusion Blades. In: in VKI Lecture Series Monographs 1992-02 on "Axial Flow Compressors". Volltext nicht online. |
Starken, H. and Steinert, W. (1992) Boundary Layer Separation and Transition Visualized by Liquid Drystal Coating. 11th Symposium on "Measuring Techniques for Transonic and Supersonic Flow in Cascades and Turbomachines" , , 14.-15.09.1992, Muenchen. Volltext nicht online. |
Starker, S. (1992) Zukunftsaspekte der GPS-Nutzung. Vortrag, gehalten auf: CCG-Lehrgang IT 11.33 "Satellitennavigation - Das Globale Positionierungs-System GPS-NAVSTAR u. seine Anwendungen", Oberpfaffenhofen, 30.6.-2.7.1992.. Volltext nicht online. |
Starker, S. (1992) Einfuehrung und Ueberblick ueber GPS-Anwendungen. Vortrag, gehalten auf: CCG-Lehrgang IT 11.33 "Satellitennavigation - Das Globale Positionierungs-System GPS-NAVSTAR und seine Anwendungen", Oberpfaffenhofen, 30.6.-2.7.1992.. Volltext nicht online. |
Starker, S. (1992) Theoretische Grundlagen zum GPS. Vortrag, gehalten auf: CCG-Lehrgang IT 11.33 "Satellitennavigation - Das Globale Positionierungs-System GPS-NAVSTAR und seine Anwendungen", Oberpfaffenhofen, 30.6.-2.7.1992.. Volltext nicht online. |
Starker, S. (1992) Systembeschreibung GPS-NAVSTAR. Vortrag, gehalten auf: CCG-Lehrgang IT 11.33 "Satellitennavigation - Das Globale Positionierungs-System GPS-NAVSTAR und seine Anwendungen", Oberpfaffenhofen, 30.6.-2.7.1992.. Volltext nicht online. |
Starker, S. (1992) Einfuehrung in die Satellitennavigation. Vortrag, gehalten auf: CCG-Lehrgang IT 11.33 "Satellitennavigation - Das Globale Positionierungs-System GPS-NAVSTAR und seine Anwendungen", Oberpfaffenhofen, 30.6.-2.7.1992.. Volltext nicht online. |
Starker, S. (1992) Das Globale Positionierungssystem (GPS)-NAVSTAR. Vortrag zum Lehrgang Nr. 16249/73.383 " Radio Ortung und Navigation", Technische Akademie Esslingen, Ostfildern (Nellingen), 9.-11.12.92.. Volltext nicht online. |
Starker, S. (1992) Grundlagen der Navigation mit Satelliten. Vortrag zum Lehrgang Nr. 16249/73.383 "Radio Ortung und Navigation", Technische Akademie Esslingen, Ostfildern (Nellingen), 9.-11.12.92.. Volltext nicht online. |
Stasicki, B. and Bretthauer, B. and Meier, G.E.A. (1992) A programmable electronic high-speed camera. 20th Int. Congress on High-Speed Photography and Photonics 21-25 Sept. 1992, Victoria Conference Centre, Victoria, British Columbia, Canada. Volltext nicht online. |
Steeb, H. (1992) The HYSOLAR Program. ASES 1992, Hydrogen Symposium June 1992, Cocoa Beach, Florida. Volltext nicht online. |
Steeb, H. (1992) Technische Aspekte der photovoltaischen Wasserstofferzeugung. Seminar des Forschungsverbundes Sonnenenergie 10./11.09.92, Berlin. Volltext nicht online. |
Steeb, H. and Aba-Oud, H. and Seeger, W. (1992) HYSOLAR. In: Proc. 9th WHEC- An Overview on the German-Saudi Arabian Program on Solar Hydrogen -, Vol. 3, pp. 1845-1854. Proc. 9th WHEC, 22nd - 25th June 1992, Paris. Volltext nicht online. |
Steeb, H. and Aba-Oud, H. and Seeger, W. (1992) HYSOLAR, An Overview on the German-Saudi-Arabien Program on Solar Hydrogen. In: Proc. 9th World Hydrogen Energy Conference June 1992, Paris, 2, pp. 1845-1855. MCI, Paris, France. Volltext nicht online. |
Stein, V. (1992) Erfahrungen mit der physikalisch-optischen Methode und der physikalischen Theorie der Beugung bei der Behandlung von Streuproblemen komplizierter Objekte. Vortrag, gehalten auf: Technische Hochschule Darmstadt, Elektrotechnisches Kolloquium, Darmstadt, 12.5.1992.. Volltext nicht online. |
Steinbach, D. (1992) Berechnung der Support-Korrekturen fuer ein Windkanal-Eichmodell und Anwendung auf Messungen. In: DGLR-DNW Fachsymposium, Korrekturverfahren fuer Modellaufh&a.ngungen in Windkan&a.len, Vol. 95, pp. 55-63. DNW, The Netherlands, 16.-17.5.1991. Volltext nicht online. |
Steinbach, D. (1992) Berechnung der Support-Korrekturen fuer ein Windkanal-Eichmodell und Anwendung auf Messungen. In: DGLR-DNW Fachsymposium, 'Korrekturverfahren f&u.r Modellaufh&a.ngungen in Windkan&a.len. DNW Holland, 16.-17.5.1991. Volltext nicht online. |
Stellbrink, K. (1992) a) Mikrostrukturelle Berechnung von FVW-Einzelschichten b) Vordimensionierung von Krafteinleitungen in FVW. Seminar Faserverbundwerkstoffe-Berechnung; DLR-Stuttgrat 3./4.Nov. 1992 Veranst.: Deutsche Ges. Materialtechnik (DGM),Oberursel/Taunus. Volltext nicht online. |
Stephani, G.* and Lehnert, F. and Staniek, G. and Peters, M. (1992) High strength and particulate reinforced aluminium alloys by melt extraction. In: Advances in Powder Metallurgy & Particulate Materials, Powder Metallurgy World Congress, June 21-26, San Francisco, 1992,Volume Nr7, Volume 7. Metal Powder Industries Federation Princeton, New Jersey, USA. Volltext nicht online. |
Sternfeld, H.J. (1992) H2/O2-Dampferzeuger zur Momentanreserve in Dampfkraftwerken. SFB 270 "Wasserstoff als Energietraeger" der Universitaet Stuttgart; 2. Juli 1992. Volltext nicht online. |
Sternfeld, H.J. (1992) Die H2/O2-Sofortreserve, eine neuartige Blockregelungsmassnahme im Dampfturbinenkraftwerk. Fachhochschule Merseburg; 4. November 1992. Volltext nicht online. |
Sternfeld, H.J. (1992) Einsatzpotential der Wasserstoff/Sauerstoff-Dampferzeugertechnologie als Ausfallreserve fuer Dampf und Strom. Oesterreichischer Mineraloelverband (OEMV), Wien, 2. November 1992. Volltext nicht online. |
Stich, G. (1) (1992) Ergebnisse der Flugleistungs- und Flugeigenschaftsuntersuchungen des Idaflieg-Sommertreffens 1991. Idaflieg-Wintertreffen, Esslingen, 09.-11.01.1992. Volltext nicht online. |
Stich, G. (1) (1992) Verbesserung der Flugeigenschaften und Leistungen in der Thermik. Symposium fuer Segelflugzeugkonstruktionen, RWTH Aachen, 18.01.1992. Volltext nicht online. |
Stich, G. (1) (1992) Flugleistungsverbesserung durch Winglets. Symposium fuer Segelflugzeugentwicklung, Stuttgart, 25.-26.11.1992. Volltext nicht online. |
Stieler, B. and Doehler, H.-U. (1992) Scene Corralation for INS Aiding in Flight-Test Systems. Runway-Referenced Flight-Test with On-Board only Sensors. Integrated and Multi-Function Navigation, AGARD Specialist Meeting, Ottawa, Canada, 14.-15. May 1992. Volltext nicht online. |
Stieler, B. and Zenz, H.-P. (1992) Sensoren zur bordautonomen Gleitpfadbestimmung. Workshop bordautonome Landung, UniBw, Neubiberg, 1.4.92. Volltext nicht online. |
Stilla, J. (1992) Grundstroemungsberechnung und lineare Stabilitaet rotationssymmetrischer, hypersonischer Grenzschichten auf der Basis eines Euler/Grenzschichtverfahrens. In: Proc. 8. DGLR Fach Symposium / DGLR Bericht 92-07.. Volltext nicht online. |
Stothard, N. and Humpfer, R. and Oser, H. and Grotheer, H.H. (1992) Measurement of the Reaction CH3+NH2 at Ambient Temperature. Internes TECFLAM-Seminar, Darmstadt, Mai 1992. Volltext nicht online. |
Stothard, N.D. and Humpfer, R. and Oser, H. and Grotheer, H.H. (1992) Measurement of the Rate Coefficient of the Reaction CH3+NH2 at 300 K over the Pressure Range 0.7-5.1 mb. 1) 24th International Symposium on Combustion, Sydney, July 1992 2) 12th Int. Symp. on Gas Kinetics, Reading, UK, July 1992. Volltext nicht online. |
Streicher, J. (1992) Simulation of a Lidar to Improve Visibility Measurements in Dense Fog. Lidar for Remote Sensing, Berlin, 24.06. - 26.06.92. Volltext nicht online. |
Streicher, J. (1992) Simulation of an airborne Doppler Lidar. In: Vortrag. Speciality Meeting on airborne Radars and Lidars, Toulouse, France, 7 - 10 July 1992. Volltext nicht online. |
Streicher, J. (1992) Algorithmen zur Inversion der Lidargleichung Simulationsprogramme für Lidar-Systeme. DFG-Workshop: Lidar zur Ableitung von Aerosol- und Wolkeneigenschaften, Okt. 21.-22, Oberpfaffenhofen. Volltext nicht online. |
Streicher, J. (1992) Erste Ergebnisse der Forschungskampagne "Madona". DLR-Kolloquium über Lidar, 10.11.92, Oberpfaffenhofen. Volltext nicht online. |
Streicher, J. and Münkel, C. and Borchardt, H. (1992) Trial of a Slant Visual Range Measuring Device. 16th International Laser Radar Conference, Massachusetts, USA, 20-24 July 1992. Volltext nicht online. |
Stricker, W. (1992) Laserspektroskopie fuer die Diagnostik von Verbrennungsvorgaengen. Kolloquium am Institut für Plasmaforschung der Universität Stuttgart, 1992. Volltext nicht online. |
Stricker, W. (1992) Temperaturmessung mit CARS an industrienahen Brennern. Festkolloquium zum 60. Geburtstag von Prof. Dr. Just, Stuttgart, Juni 1992. Volltext nicht online. |
Stricker, W. and Woyde, M. and Bergmann, V. (1992) Temperature Measurements in High Pressure Flames with Raman Techniques. 7th International Symposium on Temperature, Toronto, 1992. Volltext nicht online. |
Stuff, R. (1992) The growth of the Degree of Turbulence in a Laminar Boundary Layer Close to the Leading Edge. In: Royal Aeronautical Society, Tagung "Boundary Layer Transition & Control", Cambridge 8-12 April 1991. Royal Aeronautical Society, 4 Hamilton Place, London, W1V OBQ. Volltext nicht online. |
Stöhr, M. and Zeyfang, E. (1992) Laser Target Interaction: A Comparison between Co and CO2 Lasers. In: Proc. ECLAT (European Conference on Laser Treatment of Materials) 12. -15.10.1992, pp. 643-648. DGM Informationsgesellschaft mbH. Volltext nicht online. |
Suikat, R. (1992) A Translational Rate Command Control Law for Hover Assist. 18th European Rotorcraft Forum, Avignon, Frankreich, 15.-18.9.92. Volltext nicht online. |
Suleimanov, S. (1992) The 1000 kWt Solar Furnace in Tashkent. In: Proceedings of the First Meeting of SolarPACES Task 3 Working Group "Solar Technology and Applications", pp. 333-342. D L R - Koeln. Volltext nicht online. |
Suryanarayana, G.K. (1) and Pauer, H. and Meier, G.E.A. (1) Experimental Aerodynamics Division National Aeronautical (1992) Passive Control of the Wake of a Sphere by Ventilation. In: IUTAM-Symposium "Bluff-Body Wakes, Dynamics and Instabilities" Göttingen, 7.-11. Sept. 1992. Volltext nicht online. |
Sus, I. (1992) The PARAT 2000-Program: Computer Generated Aptitude Tests for European Aviation Personnel. WEAAPP-Tagung, Nizza, 14.-18.10.1991. Volltext nicht online. |
Szekely, J. and Schwarz, E. and Ilegbusi, J. and Egry, I. (1992) The Computation of Electromagnetic Force Fields and Transport Phenomena in Levitated Metallic Droplets. Magnetohydrodynamics in Process Metallurgy. Volltext nicht online. |
Sümnich, K.-H. and Schwarzer, H. (1992) Modularer Optoelektronischer Scanner MOS. 2. Berliner Optiktage, 29. September-1. Oktober 1992.. Volltext nicht online. |
Sümnich, K.-H. and Schwarzer, H. and Zimmermann, G. (1992) MOS - Ein multispektraler Fernerkundungssensor fuer Umweltbeobachtung. DGLR-Jahrestagung, Bremen, 29. September- 2. Oktober 1992.. Volltext nicht online. |
see editors, (1992) Life Sciences and Space Research XXIV (1): Gravitational Biology. In: Advances in Space Research, no. 1. Pergamon Press plc, Oxford, U.K.. Volltext nicht online. |
see editors, (1992) Life Sciences and Space Research XXIV (2): Radiation Biology. In: Advances in Space Research, no. 2-3. Pergamon Press plc, Oxford, U.K.. Volltext nicht online. |
see editors, (1992) Life Sciences and Space Research XXIV (3): Planetary Biology and Origins of Life. In: Advances in Space Research, No. 4. Pergamon Press plc, Oxford, U.K.. Volltext nicht online. |
T
Tank, Volker and Dietl, H. and Lindermeir, Erwin (1992) Calibration of a Fourier Transform spectrometer using three black body sources. In: SPIE Proceedings, 1575, pp. 241-243. SPIE The Society of Photo-Optical Instrumentation Engineers. Volltext nicht online. |
Teotia, H.S. and Ulbricht, K.A. and Civco, D.L. (1992) The Integration of Remote Sensing and GIS Technologies for Land Development and Irrigation Potential in the State of Ceara, Brazil. International Society of Photogrammetry and Remote Sensing XVII Congress, Washington DC, USA, August 2-14, 1992. Volltext nicht online. |
Tetzlaff, J. (1992) Automatische Antennennachfuehrung fuer den Bereich 1,4-2,5 GHz. 15. Arbeitsgruppensitzung "Bildaufklaerung"des BMVg, Braunschweig, 13.-14. Oktober 1992. Volltext nicht online. |
Thibert, J. J. and Robert, J. P. and Quast, A. (1992) The A320 Laminar Fin Programme. In: DGLR/AAAF/RAeS Proceedings First European Forum on Laminar Flow Technology, pp. 19-25. DGLR, Bonn. Volltext nicht online. |
Thiel, K. and Kölzer, G. and Grün, E. and Lorenz, E. (1992) Dust-related Phenomena of Ice-Mineral Mixture Under 1 AU Space Conditions: The Case of KOSI 9. Second International Planetary Science Conference; 24th Meeting of the Division for Planetary Science of AAS, Munich, 12-16 Oct. 1992. Volltext nicht online. |
Thiel, L. (1992) Parallelisierung des ML-Verfahrens fuer die Systemidentifizierung. Kolloquium des Sonderforschungsbereichs 212, TU Braunschweig, 05.03.1992. Volltext nicht online. |
Thielecke, F. (1992) Identifizierung instabiler flugmechanischer Systeme mit Hilfe der Mehrzielmethode. Kolloquium des Sonderforschungsbereichs 212, TU Braunschweig, 05.03.1992. Volltext nicht online. |
Thomas, H. and Kochan, H. and Ratke, L. (1992) Crushing Strength of Porous Ice-Mineral Bodies: Analogies to Comets. XVII General Assembly, Edinburgh, 6.-10.4.1992. Volltext nicht online. |
Thomas, H. and Ratke, L. and Kochan, H. (1992) Untersuchungen zur fraktalen Natur des Bruchs poroeser Eiskoerper, Hauptversammlung der Deutschen Gesellschaft fuer Materialkunde e.V., 9.-12.6.1992, Hamburg. Volltext nicht online. |
Thomas, H. and Ratke, L. and Kochan, H. (1992) Untersuchung der Festigkeit poroeser Eis-Mineral- Koeper kometarer Zusammensetzung. AEP-Fruehjahrstagung der Deutschen Phys. Ges. 30.3.-2.4.1992, TU Berlin. Volltext nicht online. |
Thomas, P.J. (1992) On the influence of the Basset history force on the motion of a particle through a fluid. Volltext nicht online. |
Tornow, C. and Richter, R. (1992) A Comparison of Two Retrieval Methods for Grand Reflectance. In: Proc. of SPIE, Vol. 1688: Atmospheric Propagation and Remote Sensing (1992), pp. 213-224. SPIE, Washington, USA. Volltext nicht online. |
Triesch, K. (1992) Untersuchungen an ebenen Verstelleinlaeufen mit hoher Innenverdichtung. Ausschussitzung "Luftatmende Antriebe", Muenchen, 21.-22.11.1991. Volltext nicht online. |
U
Uffelmann, D. and Ratke, L. and Bender, W. and Feuerbacher, B. (1992) New Mechanismen of Ostwald Ripening in Lorentz-force Stabilized Cu-Pb Dispersions. Proc. VIII European Symp. Materials and Fluid Sciences under Microgravity, Brussels 1992. Volltext nicht online. |
Ulbricht, K.A. (1992) Image Processing of Remotely Sensed Phenomena with Special Emphasis of the North-East of Brazil. In: Departamento de Engenharia Civil, Universidade Federal de Santa Catarina, Florianopolis, Santa Catarina, Brasilien, 16.10.1992. Volltext nicht online. |
Utz, H. 1) and Hornik, A. 1) and Sax, H. and Lötzerich, K. (1992) Safety and Mission Capabilities of Manned Launch Vehicles. In: Preprint IAA-92-0398, 43rd Congress of the International Astronautica l Federation, World Space Congress, 28.8-5.9.92, Washington D.C., USA. Volltext nicht online. |
V
Vajen, H.-Hermann and Spiridonow, Y.G. and Reimer, R. and Milechin, O. (1992) Empfang, Verarbeitung und Nutzung der Fernerkundungsdaten des operativen russischen Systems OKEAN. In: erscheint als Kurzfassung in den Proceedings. 9. DFD-Nutzerseminar. Volltext nicht online. |
Vessot, R.F.C. *) and et al., (1992) Hydrogen Masers for Space. ESA, Paris, France. Vortrag, gehalten auf: 6th European Frequency and Time Forum, Noordwijk, The Netherlands, 17-19 March, 1992. Proc. of the 6th European Frequency and Time Forum, ESA-SP 340.. Volltext nicht online. |
Viehweger, G. (1992) The Concept of the Kryo-Kanal Koeln (KKK), Operational Experience, Results of Flow Quality and Force Measurements at AGARD-Calibration Model. Wind-Tunnels and Wind-Tunnel Test Techniques, Southampton, 14-17 September 1992. Volltext nicht online. |
Viehweger, G. and Balden, T. and Burgsmüller, W. (1992) The Cryogenic A310 DA Wind-Tunnel Model. Development and Wind-Tunnel Test Results. Wind-Tunnels and Wind-Tunnel Test Techniques, 14-17 September 1992, Southampton, UK. Volltext nicht online. |
Visser, B., et al., (1992) Payload Operations. In: Proceedings Satellite Symposium 4 (1992) pp. 269-272, pp. 269-272. ESA Publikations Division, ESTEC Noordwijk, The Netherlands. International Space Year Conference, Munich 30 March-4 April 1992. Volltext nicht online. |
Voelkers, U. (1992) Ground Movement Control System. Air Traffic Control, Kuurne, Belgien, 8.5.92. Volltext nicht online. |
Vogt, A. and Bütefisch, K.-A. and Kompenhans, J. (1992) The evaluation of LDA Signals with low SNR by a fast opical burst analyzer. Sixth International Symposium on Applications of Laser Technique to Fluid Mechanics, July 20-23, 1992 Lisbon, Portugal; paper 24.3. Volltext nicht online. |
Vogt, A. and Raffel, M. and Kompenhans, J. (1992) Comparison of optical and digital evaluation of photographic PIV recordings. Sixth International Symposium on Applications of Laser Techniques to Fluid Mechanics, July 20-23, 1992, Lisbon, Portugal; paper 27.4. Volltext nicht online. |
Volkert, H. (1992) Mesoscale Dynamics of Flow along the Alps. Seminar, CNRM, Meteo France, Toulouse, Frankreich, 10.6.92. Volltext nicht online. |
Volkert, H. (1992) Analysis of Data in the Vicinity of Mountains: The Front Experiment '87 and PYREX '90. Seminar, Dep. of Meteorologie, Univ. of Reading, U.K., 12.8.1992. Volltext nicht online. |
Volkert, H. (1992) Flow Characteristics in the Vicinity of Mountains: Some Case Studies Using the T213 Model. Vortrag, gehalten auf: Seminar ECMWF, 12.8.92, Reading, U.K.. Volltext nicht online. |
Volkmann, T. and Loeser, W. and Herlach, D.M. (1992) Erstarrung unterkuehlter Fe-Ni-Cr Schmelzen. DPG Fruehjahrstagung, 1992-03-16 - 1992-03-20, Regensburg (D). Volltext nicht online. |
Volkmann, T. and Loeser, W. and Herlach, D.M. (1992) Solidification Behaviour of Highly Undercooled Fe-Cr-Ni Alloy Melts. Konferenz: Application of Stainless Steels, 1992-06-09 - 1992-06-11, Stockholm (S). Volltext nicht online. |
Vollmers, H. (1992) The Recovering of Flow Features from Large Numerical Data Bases. In: VKI Lecture Series on "Computer Graphics and Flow Visualization in Computational Fluid Dynamics", September 16-20, 1991, Serie 1991-07. Volltext nicht online. |
Vollmers, H. (Vortragender), Geissler, W., (1992) Kinematic Investigation of the 2-D-Flow Over an Oscillating Airfoil Under Stall. IUTAM Symposium on Bluff Body Wakes, Dynamics and Instabilities, Goettingen, 7.-11.09.1992. Volltext nicht online. |
Volz, R. (1992) Aufbringen von Hartstoffschichten auf Aluminiumlegierungen mit CO2-Lasern. Metallkunde-Kolloquium am Arlberg, 21.-25.4.92, der Montanuniversität Leoben, sterreich. Volltext nicht online. |
Volz, R. (1992) Beschichten von Kupfersubstraten durch Laserumschmelzen (EU 194 Nationales Treffen in Aachen 9.4.92). Volltext nicht online. |
Volz, R. (1992) Schweissen mit dem CO2-Laser. Handwerkskammer Reutlingen, 27.5.92. Volltext nicht online. |
Volz, R. (1992) Surface Treatment of Aluminum Alloys with High Power CO2 Lasers. In: Proc. ISATA 92 25th ISATA Silver Jubilee Int.Symp. on Automotive Technology and Automation, 31 May - 05 June 1992 (1992), pp. 301-310. Automotive Automation Limited, Croydon , UK. Volltext nicht online. |
Volz, R. (1992) Producing Hardfacing Layers on Aluminum Alloys by High Power CO2 laser. In: Laser Treatment of Materials, ed. B.L. Mordike, pp. 399-404. DGM (Informationsgesellschaft, Verlag) Oberursel 1. ECLAT 1992, 12.10.-15.10.92. Volltext nicht online. |
Voß, R. and Wegner, W. (1992) Comparison of Euler and Full Potential Methods for Unsteady Transonic Flow Calculations. In: AGARD Conference Proceedings 507, Transonic Unsteady Aerodynamics and Aeroelasticity, March 1992.. Papers presented at the 73rd Meeting of the AGARD Structures and Materials Panel, San Diegeo, CA. USA, 7th-11th October 1991.. Volltext nicht online. |
van der Wall, Berend G. (1992) Der Einfluß periodischer Anströmgeschwindigkeit auf die instationären Profilbeiwerte. 8. DGLR-Fachsymposium "Strömung mit Ablösung", 1992-11-10 - 1992-11-12, Köln-Porz. Volltext nicht online. |
van der Wall, Berend G. and Leishman, J. Gordon (1992) The Influence of Variable Flow Velocity on Unsteady Airfoil Behavior. In: 18th European Rotorcraft Forum, 81-1-81-16. 18th European Rotorcraft Forum, 1992-09-15 - 1992-09-18, Avignon, France. Volltext nicht online. |
W
Wagner, C. (1992) Some requirements to simulate soil/environment parameters for composition analysis by mid-infrared spectrometry. Mars Simulation Workshop, Bad Honnef, 27.-29.1.1992. Volltext nicht online. |
Wagner, Georg and Birk, Manfred (1992) The Far Infrared Spectrum of Ozone: Line Strengths. XIIth International Conference on High Resolution Infrared and Microwave Spectroscopy, Dobris, CSFR, 1992.. Volltext nicht online. |
Wagner, M. (Vortragender), Kleiser, L., (1992) Numerische Simulation des laminar-turbulenten Ueberganges in zweiund drei-dimensionalen Grenzschichten. GAMM Jahrestagung 1992, Leipzig 24.-28.03.1992. Volltext nicht online. |
Wagner, M. (Vortragender), Kleiser, L., (1992) Numerische Simulation des Laminar-turbulenten Ueberganges in zweiund dreidimensionalen Grenzschichten. Kurzfassung in Tagungsprogramm der GAMM Jahrestagung 1992. GAMM Jahrestagung, Leipzig, 24.-28.03.1992. Volltext nicht online. |
Wagner, M. (Vortragender), Kleiser, L., (1992) Numerische Simulation des laminar-turbulenten &U.bergangs in zweiund dreidimensionalen Grenzschichten. 8. DGLR Fach-Symposium Str&o.mungen mit Abl&o.sung, 10.-12. Nov. 1992, K&o.ln-Porz. Volltext nicht online. |
Wahl, M. and Ammendola, P. and Oettl, H. and Pampaloni, P. (1992) X-SAR: The German/Italian Contribution to Realizing a Multifrequency Synthetic Aperture Radar for Remote Sensing from Space. In: Proc. of the Central Symposium of the 'International Space Year' Conference, 3, pp. 1215-1219. European 'Internat. Space Year' Conference 1992, Munich, 30.3.-4.4.92 'Internat. Space Year' Conf. July 1992. Volltext nicht online. |
Wandernoth, B. (1992) Traegerrueckgewinnung fuer optische PSK-Homodynempfaenger mittels Synchronisationsbits. In: erscheint 1992 in den Kleinheubacher Berichten. 1. Kleinheubacher Tagung, 9.10.91, Kleinheubach. 2. DLR Institutskolloquium am 11.12.91 in OP. Volltext nicht online. |
Wandernoth, B. (1992) Traegerrueckgewinnung fuer optische PSK-Homodynempfaenger mittels Synchronisationsbits. 1. Institutskolloquium NT, 20.1.92 in OP 2. AN4/EWL-Kolloquium bei ANT am 11.3.1992 in Backnang. Volltext nicht online. |
Wandernoth, B. (1992) Low Complexity High Sensitive Optical Homodyne Receiver with a Carrier Synchronization Technique for Free Space Applications. 22nd IEEE Comm. Theory Workshop, Port Ludlow, Washington, 28.6. - 1.7.1992. Volltext nicht online. |
Weber, K. and Klein, V. and Werner, Ch. (1992) Remote Sensing Techniques for Gaseous Air Pollutants in the Troposphere Recent Developments and Applications in Germany. Opt. Rem. Sens. and Applic. to Environm. and Ind. Safety Problems Texas, Houston; 5.4. - 8.4.1992. Volltext nicht online. |
Weber, K. and Klein, V. and Werner, Ch. (1992) Remote Sensing Techniques for Gaseous Air Pollutants in the Troposphere Recent Developments and Applications in Germany. 9th World Clean Air Congress, Montreal, Canada, 30.08. - 04.09.1992. Volltext nicht online. |
Wegener, D. and Le Meur, A. and Billonnet, B. and Escande, B. and Joudren, C. (1992) Comparison between two 3D-NS-Codes and Experiment on a turbine stator. In: 28th Joint Propulsion Conference Nashville, Tennessee, 6-8 July 1992. Volltext nicht online. |
Wegner, W. (1992) Vollständige Riemannlösung der gasdynamischen Grundgleichungen. Zentrumskolloquium der DLR Göttingen am 3.12.1992. Volltext nicht online. |
Wei, B. and Herlach, D.M. (1992) Solidification Microstructures of Undercooled Co-Sb Alloys. 1st Pacific RIM International Conference on Advanced Material and Processing, 1992-06-23 - 1992-06-27, Hangzhou (China). Volltext nicht online. |
Wei, B.* and Barth, M. and Herlach, D.M. and Sommer, F.** *Northw.Polytechn.University Xian (1992) Thermodynamic Properties of Undercooled Fe-Ni Alloys. DPG Fruehjahrstagung Regensburg, 16.2-.3.1992, M 1.3. Volltext nicht online. |
Wei, B.* and Barth, M,, and Herlach, D.M. and Sommer, F.** *Northw. Polytechn. Universitz Xian (1992) Thermodynamic Properties od Undercooled Fe-Ni Alloys. DPG Fruehjahrstagung Regensburg, 16.-20.3.1992, M 1.3. Volltext nicht online. |
Weinmann, O. and Funken, K.-H. and Knoche, K.F. (RWTH Aachen), Sizmann, R. (Sektion Physik, Uni Muenchen), (1992) Decomposition of Organic Impurities in Waste Sulfuric Acid with Concentradet Solar Radiation. 6th International Syposium on Solar Thermal Concentrating Technologie Mojacar, Spain, 28th - 2nd Oct. 1992. Volltext nicht online. |
Weiß, S. and Plaetschke, E. and Rohlf, D. and Galleithner, H. (1992) System Identification for X-31A Project Support. Lessons Learned so Far. In: Proceedings of the AGARD Flight Mechanics Panel Symposium, Chania, Crete, Greece, 11 - 14 May 1992, AGARD-CP-519. Volltext nicht online. |
Welpmann, K. and Lee, Y.T. and Peters, M. (1992) Serrated Yielding of Al-Li Alloys. In: Aluminium Lithium, M. Peters, P.-J. Winkler, Eds., pp. 223-228. DGM, Oberursel. Volltext nicht online. |
Wendling, P. (1992) PRE-EUCREX Intercomparison of Radiation Flux Measurements. International Cirrus Experiment,5th Workshop, Clermont, Frankreich, 1.-4.6.1992. Volltext nicht online. |
Wendling, P. (1992) PRE-EUCREX Intercomparison of Radiation Flux Measurements. In: Proc. Intern. Cirrus Experiment, 5th Workshop in Clermont-Ferrand, France, June 1-6, 1992, pp. 81-85. International Cirrus Experiment, 5th Workshop in Clermont-Ferrand, France, June 1-6, 1992. Volltext nicht online. |
Wendt, V. (1992) Hot-Wire Measurements in Hypersonic Boundary Layers. 15th DEA-Meeting von Viscous and Interacting Flow Field Effects, 13.-15. July 1992, MBB-DASA, München. Volltext nicht online. |
Werner, Ch. and Murphy, E. and Schiesow, R. (1992) Analysis of Optical Amplifiers applied to Short-Wavelength Doppler Lidars that use Direct Detection. Lidar for Remote Sensing, Berlin, 24.6. - 26.6.92. Volltext nicht online. |
Werner, Ch. and Streicher, J. and Wildgruber, G. (1992) Representativity of Wind Measurement from Space. Space in the Service of the Changing Earth 30.04. - 04.05.92. Volltext nicht online. |
Werner, Ch. and Streicher, J. and Wildgruber, G. (1992) Representativity of Doppler Wind LidarMeasurements. In: Active Sensors and non Synchrones mission dedicated to GEWEX. Int. Symp.: Active Sensors and non Synchrones mission dedicated to GEWEX, Jour en Josas, France, 15.4. - 19.6.1992. Volltext nicht online. |
Werner, M. (1992) X-SAR, the X-Band Synthetic Aperture Radar on Board the Space Shuttle. Vortrag, gehalten auf: URSI Microwave Signatures '92, Igls-Innsbruck, Austria, 1.-3.7.92. Proc.: Conf. URSI - Microwave Signatures '92. Volltext nicht online. |
Werner, Ch., Becherer, R.J., (1992) Lidar for Remote Sensing. In: Freie Universität Berlin, 24-26 June 1992, Berlin SPIE Vol. 1714. Volltext nicht online. |
Werner, Ch., Murphy, E., Schwiesow, R., (1992) Analysis of Optical Amplifiers applied to short-wavelenght lidars that use direct detection. 1st workshop on Optical Amplifiers for LIDAR Application, Nov. 12-13, 1992, St. Malvern, U.K.. Volltext nicht online. |
Wilde, A. (1992) GECO-Experiments of the Institute for Communications Technology (DLR). GECO-Meeting in Paris, 7.-8. Juli 1992. Volltext nicht online. |
Wilhelms, Hartmut and Eineder, Michael and Coppola, Paolo and Paganone, A. (1992) Building a System for Scrrening ERS-1 Satellite Data using the HOOD Method and Ada. Eigenverlag. Second Symposium "Ada in Aerospace", 11.-15. Nov. 1991 Palazzo Barberini, Rom. Volltext nicht online. |
Wilhelms, Hartmut and Eineder, Michael and Schättler, Birgit and Noack, Wolfgang (1992) SAR Raw Data Screening as Fundamental Part of Operational SAR Processing at the German PAF. IEEE, New York, USA. IGARSS ;92, Houston, USA, May 25 - 29, 1992. Volltext nicht online. |
Wilken, D. (1992) Entwicklungschancen und Risiken des Luftverkehrs unter sich aendernden Rahmenbedingungen. DVWG-Seminar, Potsdam, 11.-12. Juni 1992. Volltext nicht online. |
Wilken, D. (1992) Auswirkungen der Liberalisierung auf den Luftverkehr der Bundesrepublik Deutschland. DGLR-Symposium, Koeln, 15. Dez. 1992. Volltext nicht online. |
Wilken, D. and Ehmer, H. and Beyhoff, S. (1992) Anhörung des Verkehrsausschusses des Landtags NRW zur Fortschreibung desr NRW-Luftverkehrskonzeption - Stellungnahme zu Fragen des Verkehrsausschusses. Beitrag als Protokoll der Anhörung - Vortrag vor dem Landtag, Datum fehlt.. Volltext nicht online. |
Williams, D.A.(1) and Greeley, R.(1) and Neukum, G. and Wagner, R, (1992) Multispectral observation of selected crater- and basin-filling Lunar Maria from Galileo Earth-Moon Encounter 1. DPS, München, 12.-16.10.92. Volltext nicht online. |
Wimmel, R. (1992) Actively Reacting Flexible Structures - Innovative through the Use of New Actuators in a Multiple Function. ACTUATOR 92, 3rd International Conference on New Actuators in Bremen, June 24-26, 1992.. Volltext nicht online. |
Wimmel, R. (1992) Adaptive Algorithms for use with Digital Filters in Vibration Control. AGARD 75th Structures and Materials Panel Meeting / Specialists' Meeting: Smart Structures for Aircraft and Spacecraft, Lindau, Germany, 4-9 October 1992.. Volltext nicht online. |
Winkler, P.-J. and Däubler, M.A. and Peters, M. (1992) Applications of Titanium Alloys in the European Aerospace Industry. 7th World Conference on Titanium, San Diego, CA, USA, 1992. Volltext nicht online. |
Winter, H. (1992) Bestimmung der S/L-Kapazitaet von Flughaefen. ADV-Fachausschuss "Planung und Bau", 31.3.92, Hamburg. Volltext nicht online. |
Winter, H. (1992) Ueberlegungen zur Strukturierung eines F+T-Schwerpunktprogrammes "Systemkonzepte". Konzept Luftfahrttechnologie, Mainz, 9.4.92. Volltext nicht online. |
Winter, H. (1992) The DLR Approach to Terminal and Airport Surface Automation. AACI/AAAE-Conference, Washington, D.C., 29.7.92. Volltext nicht online. |
Winter, H. (1992) Ergebnisse der Kapazitaets-Studie Flughafen Frankfurt. Arbeitsgruppe Flughafen Frankfurt, Braunschweig, 2.9.92. Volltext nicht online. |
Winter, H. (1992) Air Traffic Managemenr - Ein Ueberblick ueber die Situation in Deutschland. Traffic Management - Vorhandene Transportkapazitaeten besser nutzen Innsbruck, Oesterreich, 18.09.92. Volltext nicht online. |
Winter, H. (1992) Eine Einfuehrung in die Thematik Flughafenkapazitaet. Wissenschaftliches Seminar "Wege zur Steigerung der Flughafen= kapazitaet, Braunschweig, 10.-11.11.1992. Volltext nicht online. |
Winter, R. and Lotz-Iwen, H.-J. (1992) The Intelligent Satellite-Data Information System for ecological applications at the German Remote Sensing Data Center. In: Training Course, DSE Feldafing. Volltext nicht online. |
Winter, Rudolf and Keil, Manfred and Roth, Achim and Lehner, Susanne (1992) Kartierung von Umweltveränderungen mittels Fernerkundung unter Berücksichtigung der Möglichkeiten des ERS-1. In: DGPR Jena. Volltext nicht online. |
Wintergerst, K. and Frank, P. (1992) Direct Measurement of the Reaction CH4+H and CH3+H2 at Elevated Temperatures. 24th International Symposium on Combustion, Sydney, Australia, July 1992. Volltext nicht online. |
Wintergerst, K. and Frank, P. (1992) Direct Measurement of the Reaction of H-Atoms with Methane at Elevated Temperatures. 12th International Symposium on Gas Kinetics, Reading, 1992. Volltext nicht online. |
Wirth, M.(Vortragender) and Renger, W. and Ehret, G. (1992) Airborne Dial Remote Sensing of the Arctic Ozone Layer. In: Proc. 16th Intern. Laser Radar Conf., pp. 107-108. 16th Intern. Laser Radar Conf., Cambridge, Massachusetts, USA, 20.-24.7.1992. Volltext nicht online. |
Wirth, M.(Vortragender) and Renger, W. and Ehret, G. (1992) Airborne DIAL Remote Sensing of the Arctic Ozone Layer. Intern. Symp. on Lidaro for Remote Sensing and Environm. Sensing, Berlin, 22.-26.6.1992. Volltext nicht online. |
Witte, F. and Moreira, J. (Vortragender) and Palme, U. 1) (1992) Microwave Imaging in Brazil. In: Proc. IEEE Catalog Number 92 CH 3041-1, ISBN 0-7803-0138-2, 1992, pp. 428-430, pp. 428-430. The Institute of Electrical and Electronics Engineers, Inc.. IGARSS 92, 26-29 May 1992, Houston, Texas, USA. Volltext nicht online. |
Wohlrath, W.(1) and Rohardt, C.-H. and Horstmann, K.-H. (1992) The Laminar Glove on the Dornier 228 Wing-Design and First Results. DGLR, Bonn. DGLR/AAAF/RAeS First European Forum on Laminar Flow Technology, Hamburg, 16.03.1992-18.o3.1992. Volltext nicht online. |
Wolf, D.M. (1992) TRANSYS - A Software System for Preliminary Design, Analysis and Evaluation of Space Transportation Systems. Presentation at NASA Langley, Hampton, Va., January 29, 1992. Volltext nicht online. |
Wolf, D.M. (1992) TRANSYS - Ein Programmsystem fuer den Vorentwurf, die Analyse und Bewertung von Raumtransportsystemen. Präsentation bei der Deutschen Agentur für Raumfahrtangelegenheiten, Bonn, 28.04.1992. Volltext nicht online. |
Wolf, D.M. (1992) Vorauslegung von Raumtransportsystemen. Gastvorlesung, DLR Köln-Porz, 29.06.1992. Volltext nicht online. |
Wolf, D.M. (1992) TRANSYS - Ein Programmsystem fuer den Vorentwurf, die Analyse und Bewertung von Raumtransportsystemen. Präsentation bei MAN Technologie, München, Dezember 1992. Volltext nicht online. |
Wolf, D.M. (1992) TRANSYS: A Software System for Preliminary Design, Analysis and Evaluation of Space Transportation Systems. 1992 Aerospace Design Conference, Irvine, CA, February 1992, AIAA 92-1193.. Volltext nicht online. |
Wolf, Dieter M. (1992) TRANSYS: A Software System for Preliminary Desingn Analysis and Evaluation of Space Transportation Systems. AIAA Aerospace Design Conference. Volltext nicht online. |
Woyde, M. and Stricker, W. (1992) Progress in N2 High Pressure CARS Diagnostics. 10th European CARS Workshop, Garching, 18-19 March 1991.. Volltext nicht online. |
Wäsch, R. (1992) Mars und P/Halley. In: Zwei ungleiche Geschwister.. Mineralogisches Museum des Museums für Naturkunde der HUB, Berlin, April 1992. Volltext nicht online. |
Wäsch, R. (1992) To the silicatic component of comet Halley. 7. Kometenwerkstatt (KOSI), Neustadt, 29.6.-1.7.92. Volltext nicht online. |
Z
Zhang, S.J.* and Döker, H. and Nowack, H.** and Schulte, K.*** and Trautmann, K.-H. (1992) Exact Determination of Keff and Crack Propagation Prediction for selected Load Sequences. In: ASTM STP 1122 Advances in Fatigue Lifetime Predictive Techniques. ASTM, Philadelphia PA, USA. Vortrag auf dem "Second Symposium on Advances in Fatigue Lifetime predictive Technigues" Pittsburgh, 3. - 4. 05.1992. Volltext nicht online. |
Zhdanov, V.L.(1) and Eckelmann, H.(2) and Stasicki, B. (1992) Base Bleed Efficiency Criterion. IUTAM-Symposium, BLUFF-BODY WAKES; DYNAMICS AND INSTABILITIES 7-11 Sept. 1992 Germany, MPI fuer Stroemungsforschung u. Inst.f. Angewandte Mechanik u. Stroemungsphysik der Universitaet Goettingen. Volltext nicht online. |
Ziegler, V. (Vortragender) and Lueneburg, E. and Schroth, A. (1992) Mean Backscattering Properties of Random Radar Targets: A Polarimetric Covariance Matrix Concept. IEEE, Piscataway, N.J.. Vortrag, gehalten auf: IGARSS '92, Houston, Texas, 26.-29.5.92 Proc. IEEE Cat.Nr. 92 CH 3041-1, Vol. I. Volltext nicht online. |
Ziegler, V. (Vortragender) and Lueneburg, E. and Schroth, A. (1992) Weather Radar Polarimetry Path Integrated Differential Phase Shift Optimum Polarization and the Elliptical EF-Basis. Vortrag, gehalten auf: Microwave Signature '92, Igls-Innsbruck, Austria, 1.-3.7.92. Proc. Microwave Signature '92, 1992.. Volltext nicht online. |
Ziegler, V. (Vortragender): Lueneburg, E., and Schroth, A. (1992) Polarimetric Weather Radar Measurement Basis Considerations: Optimum Differential Propagation Phase Shift and the Elliptical EF-Basis. Vortrag, gehalten auf: Second International Workshop on Radar Polarimetry, Ireste, Nantes, France, 8.-10.9.92. Proc. Journees Internationales de la Polarimetrie Radar, ISBN 2-909805-01-8.. Volltext nicht online. |
Ziegler, V. (Vortragender): Lueneburg, E., and Schroth, A. (1992) Analysis of Random Radar Targets: A Polarimetric Covariance Matrix Concept. Vortrag, gehalten auf: Second Internat. Workshop on Radar Polarimetry Ireste, Nantes, France, 8.-10.9.92. Proc. Journees Internationales de la Polarimetrie Radar, ISBN 2-909805-01-8. Volltext nicht online. |
Zimmermann, G. and Bach, E. (1) (1992) German Participation Within the International Earth Observation Mission PRIRODA. In: Proc. of the Central Symposium of the ISY Conference, Munich, 30 March-4 April 1992; ESA SP-341 (1992) pp. 1079-1084, pp. 1079-1084. Volltext nicht online. |
Zimmermann, R. (1992) Auslegung fadengewickelter Druckbehaelter. Carl-Cranz-Ges. CCG, Lehrgang BW 2.02, "Strukturmechanische Berechnung im Leichtbau mit Faserverbundwerkstoffen", Braunschweig, 11.5.-15.5.1992.. Volltext nicht online. |
Zimmermann, R. (1992) Beispiele fuer die Optimierung von Verbundstrukturen. Carl-Cranz-Ges.CCG, Lehrgang BW 2.02, "Strukturmechanische Berechnung im Leichtbau mit Faserverbundwerkstoffen", Braunschweig, 11.5.-15.5.1992.. Volltext nicht online. |
Zimmermann, R. (1992) Grundlagen der Strukturoptimierung. Carl-Cranz-Ges. CCG, Lehrgang BW 2.02, "Strukturmechanische Berechnung im Leichtbau mit Faserverbundwerkstoffen", Braunschweig, 11.5.-15.5.1992.. Volltext nicht online. |
Zink, M. and Freeman, A. *) (Vortragender) (1992) An Examination of the Assumptions in the Polcal Cross-Talk Removal Algorithm. CEOS SAR-Calibration Workshop, Ottawa/Canada, 21.-25.9.92.. Volltext nicht online. |
Zink, M. (Vortragender) and Freeman, A. *) (1992) An Examination of the Assumptions in the POLCAL Cross-Talk Removal Algorithm. IEEE, Piscataway, N.J.. Vortrag, gehalten auf: IGARSS '92, Houston, Texas, 26.-29.5.92 Proc. IEEE Cat.Nr. 92 CH 3041-1, Vol. II. Volltext nicht online. |
Zink, M. (Vortragender) and Freeman, A. *) and Oettl, H. and Moghaddam, M. *) (1992) Radiometric Corrections of SAR Images of Mountainous Areas. Vortrag, gehalten auf: Microwave Signature '92, URSI, Igls-Innsbruck, Austria, 1.-3.7.92. Proc.: Microwave Signature '92.. Volltext nicht online. |
Zink, M. (Vortragener: H. Kietzmann) (1992) X-SAR Calibration Plan. CEOS SAR-Calibration Workshop, Ottawa/Canada, 21.-25.9.92.. Volltext nicht online. |
Zunker, H. and Backhaus, H.G. (1992) Laser Based Rendezvous Sensors in Test on the European Proximity Operations Simulator. In: Proceedings, pp. 1138-1146. 1992 AIAA Guidance, Navigation and Control Conference, Part 2 Hilton Head Island, August 10-12, 1992. Volltext nicht online. |